BLASTX nr result
ID: Ephedra25_contig00008423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00008423 (418 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHE79747.1| phytoene synthase [Brassica napus] 75 7e-12 gb|AEX31292.1| phytoene synthase, partial [Brassica napus] 75 7e-12 gb|AEX31285.1| phytoene synthase, partial [Brassica rapa] 75 7e-12 gb|AHE79744.1| phytoene synthase [Brassica napus] 75 9e-12 gb|AEX31294.1| phytoene synthase, partial [Brassica napus] 75 9e-12 gb|AEX31287.1| phytoene synthase, partial [Brassica oleracea] 75 9e-12 gb|ABR16198.1| unknown [Picea sitchensis] 75 1e-11 ref|XP_006855578.1| hypothetical protein AMTR_s00044p00039430 [A... 74 2e-11 gb|AAR87868.1| phytoene synthase [Oncidium hybrid cultivar] 74 2e-11 ref|XP_002981050.1| hypothetical protein SELMODRAFT_233658 [Sela... 74 3e-11 ref|XP_002982526.1| hypothetical protein SELMODRAFT_116607 [Sela... 74 3e-11 emb|CAC27383.1| phytoene synthase [Helianthus annuus] 73 3e-11 emb|CAC19567.1| phytoene synthase [Helianthus annuus] 73 3e-11 gb|AEX31291.1| phytoene synthase [Brassica napus] gi|570437856|g... 73 4e-11 gb|AEX31284.1| phytoene synthase [Brassica rapa] 73 4e-11 gb|AAM45379.1| phytoene synthase [Tagetes erecta] 73 4e-11 gb|AEC32836.1| phytoene synthase [Psidium guajava] 72 6e-11 gb|AGU91437.1| phytoene synthase [Chrysanthemum boreale] 72 8e-11 gb|EOX93101.1| Phytoene synthase [Theobroma cacao] 72 8e-11 ref|XP_004303895.1| PREDICTED: phytoene synthase, chloroplastic-... 72 8e-11 >gb|AHE79747.1| phytoene synthase [Brassica napus] Length = 418 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/57 (64%), Positives = 42/57 (73%) Frame = -2 Query: 171 EKVRRATITLNPKDTTHKPELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 + V++ + P TT LL EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 106 DDVKKPQDIVLPGTTTGSLSLLGEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 162 >gb|AEX31292.1| phytoene synthase, partial [Brassica napus] Length = 246 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/57 (64%), Positives = 42/57 (73%) Frame = -2 Query: 171 EKVRRATITLNPKDTTHKPELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 + V++ + P TT LL EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 106 DDVKKPQDIVLPGTTTGSLSLLGEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 162 >gb|AEX31285.1| phytoene synthase, partial [Brassica rapa] Length = 402 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/57 (64%), Positives = 42/57 (73%) Frame = -2 Query: 171 EKVRRATITLNPKDTTHKPELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 + V++ + P TT LL EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 104 DDVKKPQDIVLPGTTTGSLSLLGEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 160 >gb|AHE79744.1| phytoene synthase [Brassica napus] Length = 416 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/46 (78%), Positives = 37/46 (80%) Frame = -2 Query: 138 PKDTTHKPELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 P TT LL EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 115 PGTTTGSLSLLGEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 160 >gb|AEX31294.1| phytoene synthase, partial [Brassica napus] Length = 244 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/46 (78%), Positives = 37/46 (80%) Frame = -2 Query: 138 PKDTTHKPELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 P TT LL EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 115 PGTTTGSLSLLGEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 160 >gb|AEX31287.1| phytoene synthase, partial [Brassica oleracea] Length = 410 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/46 (78%), Positives = 37/46 (80%) Frame = -2 Query: 138 PKDTTHKPELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 P TT LL EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 115 PGTTTGSLSLLGEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 160 >gb|ABR16198.1| unknown [Picea sitchensis] Length = 418 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 114 ELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 ELL+EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 119 ELLNEAYERCGEVCAEYAKTFYLGTLLMTPDRRKAIWA 156 >ref|XP_006855578.1| hypothetical protein AMTR_s00044p00039430 [Amborella trichopoda] gi|548859365|gb|ERN17045.1| hypothetical protein AMTR_s00044p00039430 [Amborella trichopoda] Length = 396 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/59 (61%), Positives = 47/59 (79%), Gaps = 2/59 (3%) Frame = -2 Query: 171 EKVR-RATITLNPKDTTHKP-ELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 E+VR ++ + + P+ H ++L+EAY RCG+VCAEYAKTFYLGTLLMTP RR+AIWA Sbjct: 30 EQVRSKSVLVVRPEMVAHGSLQVLNEAYDRCGEVCAEYAKTFYLGTLLMTPERRRAIWA 88 >gb|AAR87868.1| phytoene synthase [Oncidium hybrid cultivar] Length = 412 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/57 (63%), Positives = 43/57 (75%) Frame = -2 Query: 171 EKVRRATITLNPKDTTHKPELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 +++R T+ TT LL+EAY RCGQ+CAEYAKTFYLGTLLMTP RR+AIWA Sbjct: 97 QQLRNRTVLEEKTGTTF---LLNEAYDRCGQICAEYAKTFYLGTLLMTPERRRAIWA 150 >ref|XP_002981050.1| hypothetical protein SELMODRAFT_233658 [Selaginella moellendorffii] gi|300151104|gb|EFJ17751.1| hypothetical protein SELMODRAFT_233658 [Selaginella moellendorffii] Length = 341 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 114 ELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 +LL EAY RCG++CAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 44 DLLEEAYTRCGEICAEYAKTFYLGTLLMTPERRKAIWA 81 >ref|XP_002982526.1| hypothetical protein SELMODRAFT_116607 [Selaginella moellendorffii] gi|300149625|gb|EFJ16279.1| hypothetical protein SELMODRAFT_116607 [Selaginella moellendorffii] Length = 341 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 114 ELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 +LL EAY RCG++CAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 44 DLLEEAYTRCGEICAEYAKTFYLGTLLMTPERRKAIWA 81 >emb|CAC27383.1| phytoene synthase [Helianthus annuus] Length = 414 Score = 73.2 bits (178), Expect = 3e-11 Identities = 37/53 (69%), Positives = 40/53 (75%), Gaps = 8/53 (15%) Frame = -2 Query: 135 KDTTHKPE--------LLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 +D KPE LL+EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 102 EDVDVKPEIVLPGNLGLLNEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 154 >emb|CAC19567.1| phytoene synthase [Helianthus annuus] Length = 414 Score = 73.2 bits (178), Expect = 3e-11 Identities = 37/53 (69%), Positives = 40/53 (75%), Gaps = 8/53 (15%) Frame = -2 Query: 135 KDTTHKPE--------LLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 +D KPE LL+EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 102 EDVDVKPEIVLPGNLGLLNEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 154 >gb|AEX31291.1| phytoene synthase [Brassica napus] gi|570437856|gb|AHE79746.1| phytoene synthase [Brassica napus] Length = 414 Score = 72.8 bits (177), Expect = 4e-11 Identities = 36/48 (75%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -2 Query: 138 PKDTTHKPEL--LHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 P+DT L L EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 113 PQDTVRPGSLSLLGEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 160 >gb|AEX31284.1| phytoene synthase [Brassica rapa] Length = 414 Score = 72.8 bits (177), Expect = 4e-11 Identities = 36/48 (75%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -2 Query: 138 PKDTTHKPEL--LHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 P+DT L L EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 113 PQDTVRPGSLSLLGEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 160 >gb|AAM45379.1| phytoene synthase [Tagetes erecta] Length = 399 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 111 LLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 LL+EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 103 LLNEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 139 >gb|AEC32836.1| phytoene synthase [Psidium guajava] Length = 340 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 114 ELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 +LL+EAY RCG+VCAEYAKTFYLGTLLMTP RR+A+WA Sbjct: 97 DLLNEAYERCGEVCAEYAKTFYLGTLLMTPERRRAVWA 134 >gb|AGU91437.1| phytoene synthase [Chrysanthemum boreale] Length = 436 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 111 LLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 LL EAY RCG+VCAEYAKTFYLGTLLMTP RRKAIWA Sbjct: 136 LLSEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWA 172 >gb|EOX93101.1| Phytoene synthase [Theobroma cacao] Length = 394 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 114 ELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 +LL+EAY RCG+VCAEYAKTFYLGTLLMTP RR+A+WA Sbjct: 96 DLLNEAYDRCGEVCAEYAKTFYLGTLLMTPERRRAVWA 133 >ref|XP_004303895.1| PREDICTED: phytoene synthase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 398 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 114 ELLHEAYARCGQVCAEYAKTFYLGTLLMTPYRRKAIWA 1 +LL+EAY RCG+VCAEYAKTFYLGTLLMTP RR+A+WA Sbjct: 99 DLLNEAYDRCGEVCAEYAKTFYLGTLLMTPERRRAVWA 136