BLASTX nr result
ID: Ephedra25_contig00007195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00007195 (593 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838289.1| hypothetical protein AMTR_s00103p00105930 [A... 59 1e-06 >ref|XP_006838289.1| hypothetical protein AMTR_s00103p00105930 [Amborella trichopoda] gi|548840757|gb|ERN00858.1| hypothetical protein AMTR_s00103p00105930 [Amborella trichopoda] Length = 126 Score = 58.9 bits (141), Expect = 1e-06 Identities = 34/95 (35%), Positives = 51/95 (53%) Frame = -2 Query: 286 PSSSMMVNLHWNCSKKDEQPSESAKPDKETVSARNVSRPVKDVKDKEKAGKENNLMSWLA 107 P +S+ N N + K+ S+ + K RPV +K +A Sbjct: 31 PPTSLYCNCKCNGNNKENPSSQEGERKKREREREGGWRPVVAMKKV------------VA 78 Query: 106 SFEEFMRPRKKGDIKDVLLMGVSFAIYVYISQQIV 2 + ++RPR+KGD++DVLLM +SFA+YVYISQ+IV Sbjct: 79 EMQRWVRPRRKGDLRDVLLMSLSFALYVYISQRIV 113