BLASTX nr result
ID: Ephedra25_contig00007026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00007026 (755 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004332854.1| hypothetical protein ACA1_180020 [Acanthamoe... 57 9e-06 >ref|XP_004332854.1| hypothetical protein ACA1_180020 [Acanthamoeba castellanii str. Neff] gi|440789534|gb|ELR10841.1| hypothetical protein ACA1_180020 [Acanthamoeba castellanii str. Neff] Length = 889 Score = 56.6 bits (135), Expect = 9e-06 Identities = 26/81 (32%), Positives = 55/81 (67%) Frame = +1 Query: 289 LVATGIVVVPSISMWVAMPITLTIAMTVCISLTMGIAFTFSITLPMRKAIVVSIAMSMSI 468 LVA +VV ++ + + IT+TI +T+ I++T+ I T +IT+ + I ++I ++++I Sbjct: 145 LVAAVVVVGLLFTITITITITITITITITITITITITITITITITITITITITITITITI 204 Query: 469 TLSMATTISISMTFNMALTVL 531 T+++ TI+I++T + +T+L Sbjct: 205 TITITITITITITITITITIL 225