BLASTX nr result
ID: Ephedra25_contig00006123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00006123 (421 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidop... 97 2e-18 gb|ACA61610.1| hypothetical protein AP2_E06.1 [Arabidopsis lyrat... 97 2e-18 ref|XP_006464959.1| PREDICTED: 26S protease regulatory subunit 6... 96 6e-18 gb|ESW18898.1| hypothetical protein PHAVU_006G080300g [Phaseolus... 96 6e-18 ref|XP_006432050.1| hypothetical protein CICLE_v10003767mg [Citr... 96 6e-18 ref|XP_006401107.1| hypothetical protein EUTSA_v10013708mg [Eutr... 96 6e-18 ref|XP_002307945.2| 26S proteasome subunit 7 family protein [Pop... 96 6e-18 gb|EOY19210.1| Regulatory particle triple-A ATPase 3 isoform 2, ... 96 6e-18 gb|EOY19209.1| Regulatory particle triple-A ATPase 3 isoform 1 [... 96 6e-18 ref|XP_004242474.1| PREDICTED: 26S protease regulatory subunit 6... 96 6e-18 ref|XP_004242453.1| PREDICTED: 26S protease regulatory subunit 6... 96 6e-18 ref|XP_004154554.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease... 96 6e-18 ref|XP_004139931.1| PREDICTED: 26S protease regulatory subunit 6... 96 6e-18 ref|XP_002276130.2| PREDICTED: 26S protease regulatory subunit 6... 96 6e-18 ref|XP_003553190.1| PREDICTED: 26S protease regulatory subunit 6... 96 6e-18 emb|CBI15803.3| unnamed protein product [Vitis vinifera] 96 6e-18 ref|XP_002523664.1| 26S protease regulatory subunit 6b, putative... 96 6e-18 ref|XP_006405326.1| hypothetical protein EUTSA_v10027786mg [Eutr... 94 1e-17 ref|XP_004500390.1| PREDICTED: 26S protease regulatory subunit 6... 94 1e-17 gb|AFK43608.1| unknown [Medicago truncatula] 94 1e-17 >ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] gi|297793353|ref|XP_002864561.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|565430379|ref|XP_006279634.1| hypothetical protein CARUB_v10026512mg [Capsella rubella] gi|28558168|sp|Q9SEI4.1|PRS6B_ARATH RecName: Full=26S protease regulatory subunit 6B homolog; AltName: Full=26S protease subunit 6B homolog; AltName: Full=26S proteasome AAA-ATPase subunit RPT3; AltName: Full=Protein BMAA insensitive morphology 409; AltName: Full=Regulatory particle triple-A ATPase subunit 3 gi|6652882|gb|AAF22523.1|AF123392_1 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|8777330|dbj|BAA96920.1| 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|17979231|gb|AAL49932.1| AT4g10340/F24G24_140 [Arabidopsis thaliana] gi|56382019|gb|AAV85728.1| At5g58290 [Arabidopsis thaliana] gi|297310396|gb|EFH40820.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|332009646|gb|AED97029.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] gi|482548338|gb|EOA12532.1| hypothetical protein CARUB_v10026512mg [Capsella rubella] Length = 408 Score = 97.1 bits (240), Expect = 2e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 363 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 408 >gb|ACA61610.1| hypothetical protein AP2_E06.1 [Arabidopsis lyrata subsp. petraea] Length = 172 Score = 97.1 bits (240), Expect = 2e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 127 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 172 >ref|XP_006464959.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Citrus sinensis] Length = 412 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 367 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 412 >gb|ESW18898.1| hypothetical protein PHAVU_006G080300g [Phaseolus vulgaris] Length = 420 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 375 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 420 >ref|XP_006432050.1| hypothetical protein CICLE_v10003767mg [Citrus clementina] gi|557534172|gb|ESR45290.1| hypothetical protein CICLE_v10003767mg [Citrus clementina] Length = 395 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 350 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 395 >ref|XP_006401107.1| hypothetical protein EUTSA_v10013708mg [Eutrema salsugineum] gi|557102197|gb|ESQ42560.1| hypothetical protein EUTSA_v10013708mg [Eutrema salsugineum] Length = 404 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEI AICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 359 AEITAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 404 >ref|XP_002307945.2| 26S proteasome subunit 7 family protein [Populus trichocarpa] gi|550335334|gb|EEE91468.2| 26S proteasome subunit 7 family protein [Populus trichocarpa] Length = 384 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 339 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 384 >gb|EOY19210.1| Regulatory particle triple-A ATPase 3 isoform 2, partial [Theobroma cacao] Length = 291 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 246 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 291 >gb|EOY19209.1| Regulatory particle triple-A ATPase 3 isoform 1 [Theobroma cacao] Length = 419 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 374 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 419 >ref|XP_004242474.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Solanum lycopersicum] Length = 414 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 369 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 414 >ref|XP_004242453.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Solanum lycopersicum] Length = 414 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 369 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 414 >ref|XP_004154554.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 6B homolog [Cucumis sativus] Length = 418 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 373 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 >ref|XP_004139931.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Cucumis sativus] Length = 418 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 373 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 >ref|XP_002276130.2| PREDICTED: 26S protease regulatory subunit 6B homolog [Vitis vinifera] Length = 418 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 373 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 >ref|XP_003553190.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Glycine max] Length = 422 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 377 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 422 >emb|CBI15803.3| unnamed protein product [Vitis vinifera] Length = 328 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 283 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 328 >ref|XP_002523664.1| 26S protease regulatory subunit 6b, putative [Ricinus communis] gi|223537064|gb|EEF38699.1| 26S protease regulatory subunit 6b, putative [Ricinus communis] Length = 415 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 370 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 415 >ref|XP_006405326.1| hypothetical protein EUTSA_v10027786mg [Eutrema salsugineum] gi|557106464|gb|ESQ46779.1| hypothetical protein EUTSA_v10027786mg [Eutrema salsugineum] Length = 408 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEI AICQEAGMHAVRKNRYVILPKDF+KGYRANVKKPDT+FEFYK Sbjct: 363 AEITAICQEAGMHAVRKNRYVILPKDFDKGYRANVKKPDTDFEFYK 408 >ref|XP_004500390.1| PREDICTED: 26S protease regulatory subunit 6B homolog isoform X2 [Cicer arietinum] Length = 418 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEI+AICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 373 AEISAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 >gb|AFK43608.1| unknown [Medicago truncatula] Length = 415 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 419 AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 282 AEI+AICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 370 AEISAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 415