BLASTX nr result
ID: Ephedra25_contig00006005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00006005 (936 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004978840.1| PREDICTED: superkiller viralicidic activity ... 52 8e-06 >ref|XP_004978840.1| PREDICTED: superkiller viralicidic activity 2-like 2-like [Setaria italica] Length = 1008 Score = 52.4 bits (124), Expect(2) = 8e-06 Identities = 36/90 (40%), Positives = 52/90 (57%), Gaps = 5/90 (5%) Frame = -2 Query: 866 LSEYHHVRLNLSQLEKNLMSEITT*TGSA---VPGSR*TGKDKR--WYL*LGMGXXXXXV 702 L+EYH + L++S+LEK +MSE+ + VPG +D W G G V Sbjct: 583 LAEYHKLGLDISELEKKIMSEMIRPERALLYLVPGRLVKVRDGSTDW----GWGVVVNVV 638 Query: 701 KKPPAIPSTLPSVVLSSWTSSYLLDTLIHC 612 KKPPA TLP + +S ++SY++DTL+HC Sbjct: 639 KKPPA-SGTLPPALSASRSNSYIVDTLLHC 667 Score = 24.6 bits (52), Expect(2) = 8e-06 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -1 Query: 624 IDTL--CPSGLNTDGXXXXXXXXXPGQKGEMPVV 529 +DTL C S N +G PG+KGEM VV Sbjct: 661 VDTLLHCSSSSNENGSRSKPCPPRPGEKGEMHVV 694