BLASTX nr result
ID: Ephedra25_contig00005448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00005448 (753 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_743348.1| hypothetical protein [Plasmodium chabaudi chaba... 78 4e-12 ref|XP_673989.1| histone H2B [Plasmodium berghei strain ANKA] gi... 78 4e-12 ref|XP_738275.1| histone H2B [Plasmodium chabaudi chabaudi] gi|5... 78 4e-12 ref|XP_002259051.1| histone h2b [Plasmodium knowlesi strain H] g... 78 4e-12 gb|ABK26056.1| unknown [Picea sitchensis] 77 6e-12 gb|ABK25053.1| unknown [Picea sitchensis] 77 6e-12 gb|EUD65516.1| histone H2B [Plasmodium inui San Antonio 1] 77 8e-12 gb|ETW52672.1| histone H2B [Plasmodium falciparum Palo Alto/Ugan... 77 8e-12 ref|XP_004222282.1| histone 2B, partial [Plasmodium cynomolgi st... 77 8e-12 ref|XP_001347738.1| histone H2B [Plasmodium falciparum 3D7] gi|2... 77 8e-12 ref|XP_001615180.1| histone 2B [Plasmodium vivax Sal-1] gi|41384... 77 8e-12 ref|XP_001609700.1| histone 2B protein [Babesia bovis T2Bo] gi|1... 75 2e-11 ref|XP_004831169.1| histone H2B, putative [Babesia equi] gi|4293... 75 2e-11 gb|EGZ28455.1| hypothetical protein PHYSODRAFT_284271 [Phytophth... 75 2e-11 gb|EGZ28397.1| hypothetical protein PHYSODRAFT_473259 [Phytophth... 75 2e-11 ref|XP_002906668.1| histone H2B [Phytophthora infestans T30-4] g... 75 2e-11 ref|XP_002906611.1| histone H2B [Phytophthora infestans T30-4] g... 75 2e-11 emb|CDJ45845.1| histone H2B, putative [Eimeria brunetti] 75 3e-11 emb|CDI79165.1| histone H2B, putative [Eimeria acervulina] 75 3e-11 gb|AAC46612.1| histone H2B [Plasmodium falciparum] 75 3e-11 >ref|XP_743348.1| hypothetical protein [Plasmodium chabaudi chabaudi] gi|56522804|emb|CAH80729.1| hypothetical protein PC000195.04.0 [Plasmodium chabaudi chabaudi] gi|564276506|gb|ETB57954.1| histone H2B.4 [Plasmodium yoelii 17X] gi|577149616|gb|EUD72677.1| histone H2B [Plasmodium vinckei petteri] Length = 118 Score = 77.8 bits (190), Expect = 4e-12 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y+KRDTLSSRE+QTA+RLVLPGEL+KHAVSEGTKAVTKFTS Sbjct: 77 YTKRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTS 117 >ref|XP_673989.1| histone H2B [Plasmodium berghei strain ANKA] gi|68069153|ref|XP_676487.1| hypothetical protein [Plasmodium berghei strain ANKA] gi|56492233|emb|CAI02484.1| histone H2B, putative [Plasmodium berghei] gi|56496208|emb|CAH95049.1| hypothetical protein PB001051.00.0 [Plasmodium berghei] Length = 118 Score = 77.8 bits (190), Expect = 4e-12 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y+KRDTLSSRE+QTA+RLVLPGEL+KHAVSEGTKAVTKFTS Sbjct: 77 YTKRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTS 117 >ref|XP_738275.1| histone H2B [Plasmodium chabaudi chabaudi] gi|56514359|emb|CAH86976.1| histone H2B, putative [Plasmodium chabaudi chabaudi] Length = 131 Score = 77.8 bits (190), Expect = 4e-12 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y+KRDTLSSRE+QTA+RLVLPGEL+KHAVSEGTKAVTKFTS Sbjct: 77 YTKRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTS 117 >ref|XP_002259051.1| histone h2b [Plasmodium knowlesi strain H] gi|193809122|emb|CAQ39824.1| histone h2b, putative [Plasmodium knowlesi strain H] Length = 117 Score = 77.8 bits (190), Expect = 4e-12 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y+KRDTLSSRE+QTA+RLVLPGEL+KHAVSEGTKAVTKFTS Sbjct: 76 YTKRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTS 116 >gb|ABK26056.1| unknown [Picea sitchensis] Length = 164 Score = 77.0 bits (188), Expect = 6e-12 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y KRDTLSSREVQTAV+LVLPGEL+KHAVSEGTKAVTKFTS Sbjct: 123 YGKRDTLSSREVQTAVKLVLPGELAKHAVSEGTKAVTKFTS 163 >gb|ABK25053.1| unknown [Picea sitchensis] Length = 162 Score = 77.0 bits (188), Expect = 6e-12 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y KRDTLSSREVQTAV+LVLPGEL+KHAVSEGTKAVTKFTS Sbjct: 121 YGKRDTLSSREVQTAVKLVLPGELAKHAVSEGTKAVTKFTS 161 >gb|EUD65516.1| histone H2B [Plasmodium inui San Antonio 1] Length = 63 Score = 76.6 bits (187), Expect = 8e-12 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y++RDTLSSRE+QTA+RLVLPGEL+KHAVSEGTKAVTKFTS Sbjct: 22 YTRRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTS 62 >gb|ETW52672.1| histone H2B [Plasmodium falciparum Palo Alto/Uganda] gi|579122020|gb|EUR70651.1| histone H2B [Plasmodium falciparum 7G8] gi|583214777|gb|EWC76083.1| histone H2B [Plasmodium falciparum UGT5.1] Length = 66 Score = 76.6 bits (187), Expect = 8e-12 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y++RDTLSSRE+QTA+RLVLPGEL+KHAVSEGTKAVTKFTS Sbjct: 25 YTRRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTS 65 >ref|XP_004222282.1| histone 2B, partial [Plasmodium cynomolgi strain B] gi|389583601|dbj|GAB66335.1| histone 2B, partial [Plasmodium cynomolgi strain B] Length = 117 Score = 76.6 bits (187), Expect = 8e-12 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y++RDTLSSRE+QTA+RLVLPGEL+KHAVSEGTKAVTKFTS Sbjct: 77 YTRRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTS 117 >ref|XP_001347738.1| histone H2B [Plasmodium falciparum 3D7] gi|23495988|gb|AAN35651.1|AE014836_48 histone H2B [Plasmodium falciparum 3D7] gi|574749784|gb|ETW17924.1| histone H2B.4 [Plasmodium falciparum Vietnam Oak-Knoll (FVO)] gi|574963706|gb|ETW27035.1| histone H2B.4 [Plasmodium falciparum FCH/4] gi|574980518|gb|ETW42289.1| histone H2B.4 [Plasmodium falciparum NF135/5.C10] gi|574987533|gb|ETW48814.1| histone H2B.4 [Plasmodium falciparum MaliPS096_E11] gi|575000410|gb|ETW60883.1| histone H2B.4 [Plasmodium falciparum CAMP/Malaysia] Length = 117 Score = 76.6 bits (187), Expect = 8e-12 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y++RDTLSSRE+QTA+RLVLPGEL+KHAVSEGTKAVTKFTS Sbjct: 76 YTRRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTS 116 >ref|XP_001615180.1| histone 2B [Plasmodium vivax Sal-1] gi|4138413|emb|CAA76839.1| histone 2B [Plasmodium vivax] gi|148804054|gb|EDL45453.1| histone 2B [Plasmodium vivax] Length = 118 Score = 76.6 bits (187), Expect = 8e-12 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y++RDTLSSRE+QTA+RLVLPGEL+KHAVSEGTKAVTKFTS Sbjct: 77 YTRRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTS 117 >ref|XP_001609700.1| histone 2B protein [Babesia bovis T2Bo] gi|154796952|gb|EDO06132.1| histone 2B protein, putative [Babesia bovis] Length = 106 Score = 75.5 bits (184), Expect = 2e-11 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFT 120 Y+K++TLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFT Sbjct: 65 YNKKETLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFT 104 >ref|XP_004831169.1| histone H2B, putative [Babesia equi] gi|429329744|gb|AFZ81503.1| histone H2B, putative [Babesia equi] Length = 118 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFT 120 Y+K++TLSSRE+QTAVRLVLPGELSKHAVSEGTKAVTKFT Sbjct: 75 YNKKETLSSREIQTAVRLVLPGELSKHAVSEGTKAVTKFT 114 >gb|EGZ28455.1| hypothetical protein PHYSODRAFT_284271 [Phytophthora sojae] Length = 117 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTSA 126 Y+K+ TLSSRE+QTAVRL+LPGEL+KHAVSEGTKAVTKFTSA Sbjct: 76 YNKKSTLSSREIQTAVRLMLPGELAKHAVSEGTKAVTKFTSA 117 >gb|EGZ28397.1| hypothetical protein PHYSODRAFT_473259 [Phytophthora sojae] Length = 115 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTSA 126 Y+K+ TLSSRE+QTAVRL+LPGEL+KHAVSEGTKAVTKFTSA Sbjct: 74 YNKKSTLSSREIQTAVRLMLPGELAKHAVSEGTKAVTKFTSA 115 >ref|XP_002906668.1| histone H2B [Phytophthora infestans T30-4] gi|262108017|gb|EEY66069.1| histone H2B [Phytophthora infestans T30-4] gi|566020866|gb|ETI43777.1| histone H2B [Phytophthora parasitica P1569] gi|567958250|gb|ETK83842.1| histone H2B [Phytophthora parasitica] gi|567986942|gb|ETL37257.1| histone H2B [Phytophthora parasitica] gi|568016219|gb|ETL90396.1| histone H2B [Phytophthora parasitica] gi|568046596|gb|ETM43701.1| histone H2B [Phytophthora parasitica] gi|568092212|gb|ETN07021.1| histone H2B [Phytophthora parasitica INRA-310] gi|570324505|gb|ETO72453.1| histone H2B [Phytophthora parasitica P1976] gi|570948331|gb|ETP13588.1| histone H2B [Phytophthora parasitica CJ01A1] gi|570981177|gb|ETP41651.1| histone H2B [Phytophthora parasitica P10297] Length = 117 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTSA 126 Y+K+ TLSSRE+QTAVRL+LPGEL+KHAVSEGTKAVTKFTSA Sbjct: 76 YNKKSTLSSREIQTAVRLMLPGELAKHAVSEGTKAVTKFTSA 117 >ref|XP_002906611.1| histone H2B [Phytophthora infestans T30-4] gi|262107960|gb|EEY66012.1| histone H2B [Phytophthora infestans T30-4] gi|566026130|gb|ETI49041.1| histone H2B [Phytophthora parasitica P1569] gi|567963410|gb|ETK88909.1| histone H2B [Phytophthora parasitica] gi|567992108|gb|ETL42307.1| histone H2B [Phytophthora parasitica] gi|568021391|gb|ETL95481.1| histone H2B [Phytophthora parasitica] gi|568051781|gb|ETM48680.1| histone H2B [Phytophthora parasitica] gi|568096406|gb|ETN11157.1| histone H2B [Phytophthora parasitica INRA-310] gi|570329831|gb|ETO77779.1| histone H2B [Phytophthora parasitica P1976] gi|570953551|gb|ETP18808.1| histone H2B [Phytophthora parasitica CJ01A1] gi|570988262|gb|ETP46729.1| histone H2B [Phytophthora parasitica P10297] Length = 115 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTSA 126 Y+K+ TLSSRE+QTAVRL+LPGEL+KHAVSEGTKAVTKFTSA Sbjct: 74 YNKKSTLSSREIQTAVRLMLPGELAKHAVSEGTKAVTKFTSA 115 >emb|CDJ45845.1| histone H2B, putative [Eimeria brunetti] Length = 125 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFT 120 Y+K+DTLSSREVQTAVRLVLPGEL+KHAVSEGTKAVTK+T Sbjct: 84 YNKKDTLSSREVQTAVRLVLPGELAKHAVSEGTKAVTKYT 123 >emb|CDI79165.1| histone H2B, putative [Eimeria acervulina] Length = 116 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFT 120 Y+K+DTLSSREVQTAVRLVLPGEL+KHAVSEGTKAVTK+T Sbjct: 75 YNKKDTLSSREVQTAVRLVLPGELAKHAVSEGTKAVTKYT 114 >gb|AAC46612.1| histone H2B [Plasmodium falciparum] Length = 117 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = +1 Query: 1 YSKRDTLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTS 123 Y++RDTLSSRE+QTA+RLVLPGEL+KHAVSEGTKAV KFTS Sbjct: 76 YTRRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVAKFTS 116