BLASTX nr result
ID: Ephedra25_contig00005415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00005415 (676 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69295.1| hypothetical protein M569_05471 [Genlisea aurea] 57 5e-06 ref|XP_002313352.2| hypothetical protein POPTR_0009s05520g, part... 56 9e-06 >gb|EPS69295.1| hypothetical protein M569_05471 [Genlisea aurea] Length = 426 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/34 (64%), Positives = 33/34 (97%) Frame = -2 Query: 102 MDAYEASRIVFTRIQCMEPDNASKIVGYLLLQDR 1 MD+YEA+++V +RIQC++PDNASKI+GY+L+QD+ Sbjct: 1 MDSYEATKVVMSRIQCLDPDNASKIMGYILIQDQ 34 >ref|XP_002313352.2| hypothetical protein POPTR_0009s05520g, partial [Populus trichocarpa] gi|550331093|gb|EEE87307.2| hypothetical protein POPTR_0009s05520g, partial [Populus trichocarpa] Length = 728 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -2 Query: 105 SMDAYEASRIVFTRIQCMEPDNASKIVGYLLLQD 4 +MD+YEA+ IVF+RIQ +EP+NASKI+GYLLLQD Sbjct: 43 TMDSYEATNIVFSRIQSLEPENASKIMGYLLLQD 76