BLASTX nr result
ID: Ephedra25_contig00004436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00004436 (560 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006650546.1| PREDICTED: proteinase inhibitor type-2 CEVI5... 58 1e-06 >ref|XP_006650546.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Oryza brachyantha] Length = 83 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/91 (34%), Positives = 43/91 (47%), Gaps = 3/91 (3%) Frame = -3 Query: 477 SLTVILFICFFIAFSEMKAVSAYGNEGVTGNSRRLMQICPQFCYDDIKDSSC---GETVL 307 +L + L +C + +++ A G +ICPQFCYD I+ +C G L Sbjct: 7 ALPMALLLCGLVLIGSLQSTEAQGGG----------KICPQFCYDGIEYMTCPSTGSQRL 56 Query: 306 KPYCNCCILRSHHPDAKNCQINLENGQTIAC 214 KP CNCC+ D C I L NGQ + C Sbjct: 57 KPVCNCCL-----ADENGCAIYLNNGQVVNC 82