BLASTX nr result
ID: Ephedra25_contig00004423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00004423 (656 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB88628.1| 85 kDa cold acclimation protein [Spinacia oleracea] 57 5e-06 >gb|AAB88628.1| 85 kDa cold acclimation protein [Spinacia oleracea] Length = 535 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/74 (41%), Positives = 43/74 (58%), Gaps = 10/74 (13%) Frame = +1 Query: 13 IMDKIDDS---KSEEDHNQYHHEEGDEKEKRYMDKIK-------EQKNEEYHYHGMEGEK 162 ++DKI D + E+ N YHH + +EK+ +DKIK E K +YH+H E EK Sbjct: 222 VLDKIKDKLPGQHEDKKNDYHHHQEEEKKDSVLDKIKDKMSGQHEDKKNDYHHH-QEEEK 280 Query: 163 KLGLMDKFKQKLHG 204 K G++DK K KL G Sbjct: 281 KGGVLDKIKDKLPG 294