BLASTX nr result
ID: Ephedra25_contig00003784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00003784 (2016 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001598279.1| hypothetical protein SS1G_00365 [Sclerotinia... 59 8e-06 >ref|XP_001598279.1| hypothetical protein SS1G_00365 [Sclerotinia sclerotiorum 1980] gi|154691227|gb|EDN90965.1| hypothetical protein SS1G_00365 [Sclerotinia sclerotiorum 1980 UF-70] Length = 1181 Score = 58.9 bits (141), Expect = 8e-06 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 3/78 (3%) Frame = -3 Query: 1567 MIEFDDQHSKKMLKYVIGTFRWPVPGFEDLIPTFLIRKHECKNYYHLSIASTCENMLKLP 1388 M EF+D+ +K+LKYV T R P+ GF L+P F IR + L ASTC N+LKLP Sbjct: 1098 MKEFEDEDRRKVLKYVTSTPRAPLLGFSSLVPRFSIRDGSL-DEKRLPSASTCVNLLKLP 1156 Query: 1387 PY---KVLKERLF*VINS 1343 Y + LKE+L IN+ Sbjct: 1157 RYQSKEKLKEKLLYAINA 1174