BLASTX nr result
ID: Ephedra25_contig00003180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00003180 (485 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR16166.1| unknown [Picea sitchensis] 72 6e-11 gb|AAL40352.1|AF448201_1 putative alpha-xylosidase [Pinus pinaster] 70 3e-10 gb|AFG49674.1| hypothetical protein CL996Contig1_03, partial [Pi... 58 1e-06 >gb|ABR16166.1| unknown [Picea sitchensis] Length = 908 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/108 (34%), Positives = 59/108 (54%), Gaps = 9/108 (8%) Frame = +3 Query: 3 MGLSAGSSTYVEFNAETDGKKVRVMSKVQHGEYALSQKWIIETXXXXXXXXXXXXXXXXX 182 M ++ G STY++F+AE+DGKK R+MS VQ+G YALSQ W++E Sbjct: 796 MKIAEGKSTYIDFSAESDGKKARLMSHVQNGAYALSQGWVVEKLIILGLPSSHSSSQLAF 855 Query: 183 XDGETVLGDAGYT---------VEAAKGGRFMELKGLSIPVGKSFDLS 299 + +T ++ ++GG M+L GL++P+G++ DLS Sbjct: 856 QLDGKPFSSSSFTYSAQSHSTNIDKSQGGAIMDLNGLALPLGRNIDLS 903 >gb|AAL40352.1|AF448201_1 putative alpha-xylosidase [Pinus pinaster] Length = 910 Score = 70.1 bits (170), Expect = 3e-10 Identities = 41/109 (37%), Positives = 61/109 (55%), Gaps = 10/109 (9%) Frame = +3 Query: 3 MGLSAGSSTYVEFNAETDGKKVRVMSKVQHGEYALSQKWIIE-TXXXXXXXXXXXXXXXX 179 M ++ G STYV+F+AE+DGKKVR++S+V+ G Y LSQ W++E Sbjct: 799 MKIAEGKSTYVDFSAESDGKKVRLVSQVESGSYGLSQGWVVEKLMILGLSKSHLSSQIAF 858 Query: 180 XXDGETVLGDA-GYTV--------EAAKGGRFMELKGLSIPVGKSFDLS 299 DG+ + Y+V ++ GG MEL GL++PVG++ DLS Sbjct: 859 QLDGKPFTSSSFTYSVQPLSTSAEQSQGGGAIMELNGLALPVGRNIDLS 907 >gb|AFG49674.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137153|gb|AFG49675.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137155|gb|AFG49676.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137157|gb|AFG49677.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137159|gb|AFG49678.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137161|gb|AFG49679.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137163|gb|AFG49680.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137165|gb|AFG49681.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137167|gb|AFG49682.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137169|gb|AFG49683.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137171|gb|AFG49684.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137173|gb|AFG49685.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137175|gb|AFG49686.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137177|gb|AFG49687.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137179|gb|AFG49688.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137181|gb|AFG49689.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137183|gb|AFG49690.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] gi|383137185|gb|AFG49691.1| hypothetical protein CL996Contig1_03, partial [Pinus taeda] Length = 72 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +3 Query: 3 MGLSAGSSTYVEFNAETDGKKVRVMSKVQHGEYALSQKWIIE 128 M ++ G STYV+F+AE+DGKKVR++S+V+ G Y LSQ W++E Sbjct: 2 MKIAEGKSTYVDFSAESDGKKVRLVSQVESGSYGLSQGWVVE 43