BLASTX nr result
ID: Ephedra25_contig00002946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00002946 (542 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006287170.1| hypothetical protein CARUB_v10000355mg [Caps... 56 6e-06 >ref|XP_006287170.1| hypothetical protein CARUB_v10000355mg [Capsella rubella] gi|482555876|gb|EOA20068.1| hypothetical protein CARUB_v10000355mg [Capsella rubella] Length = 697 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +3 Query: 3 GMLQNFSWENAASQYEQIFEWAMIDPPYVA 92 GM QN+SWENAA QYEQ+F+W +DPPYV+ Sbjct: 668 GMTQNYSWENAAVQYEQVFQWVFMDPPYVS 697