BLASTX nr result
ID: Ephedra25_contig00002901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00002901 (403 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containi... 118 7e-25 gb|EXC20884.1| CDGSH iron-sulfur domain-containing protein 2A [M... 114 1e-23 ref|XP_002960535.1| hypothetical protein SELMODRAFT_437606 [Sela... 113 2e-23 ref|XP_001779929.1| predicted protein [Physcomitrella patens] gi... 113 2e-23 ref|XP_002318867.1| hypothetical protein POPTR_0012s14230g [Popu... 112 4e-23 ref|XP_006490265.1| PREDICTED: CDGSH iron-sulfur domain-containi... 112 5e-23 ref|XP_006421772.1| hypothetical protein CICLE_v10006560mg, part... 112 5e-23 ref|XP_004506290.1| PREDICTED: CDGSH iron-sulfur domain-containi... 112 5e-23 emb|CBI24493.3| unnamed protein product [Vitis vinifera] 111 9e-23 ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containi... 111 9e-23 gb|ABK20944.1| unknown [Picea sitchensis] 111 9e-23 ref|XP_002321854.2| hypothetical protein POPTR_0015s14240g [Popu... 111 1e-22 ref|XP_001783842.1| predicted protein [Physcomitrella patens] gi... 111 1e-22 ref|XP_002510894.1| conserved hypothetical protein [Ricinus comm... 110 2e-22 gb|AFK46198.1| unknown [Lotus japonicus] 108 6e-22 gb|ESW24382.1| hypothetical protein PHAVU_004G125800g [Phaseolus... 108 7e-22 gb|EPS66502.1| hypothetical protein M569_08279 [Genlisea aurea] 108 9e-22 gb|EMJ19796.1| hypothetical protein PRUPE_ppa013339mg [Prunus pe... 107 1e-21 ref|XP_003563153.1| PREDICTED: CDGSH iron-sulfur domain-containi... 107 1e-21 ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycin... 107 1e-21 >ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] gi|449506515|ref|XP_004162771.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] Length = 108 Score = 118 bits (296), Expect = 7e-25 Identities = 59/88 (67%), Positives = 65/88 (73%) Frame = +3 Query: 21 NAKSKGVRRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLS 200 N G RR++VVRAE GSS IN IRK+E+KVVD V V +LSKP T YCRCW S Sbjct: 24 NFNDNGRRRTVVVRAE---GGSSGEHINPAIRKSEDKVVDSVLVPELSKPLTPYCRCWRS 80 Query: 201 KTFPLCDGTHAKHNKETGDNVGPLLLKK 284 TFPLCDG+H KHNK TGDNVGPLLLKK Sbjct: 81 GTFPLCDGSHVKHNKATGDNVGPLLLKK 108 >gb|EXC20884.1| CDGSH iron-sulfur domain-containing protein 2A [Morus notabilis] Length = 117 Score = 114 bits (286), Expect = 1e-23 Identities = 59/88 (67%), Positives = 64/88 (72%) Frame = +3 Query: 21 NAKSKGVRRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLS 200 N KS+ RR +VVRAE Q IN IRK+EEKVVD V V +LSKP T YCRCW S Sbjct: 36 NFKSRSSRRLVVVRAEGQ-------AINPEIRKSEEKVVDSVVVTELSKPLTPYCRCWRS 88 Query: 201 KTFPLCDGTHAKHNKETGDNVGPLLLKK 284 TFPLCDG+H KHNK TGDNVGPLLLKK Sbjct: 89 GTFPLCDGSHVKHNKATGDNVGPLLLKK 116 >ref|XP_002960535.1| hypothetical protein SELMODRAFT_437606 [Selaginella moellendorffii] gi|300171474|gb|EFJ38074.1| hypothetical protein SELMODRAFT_437606 [Selaginella moellendorffii] Length = 628 Score = 113 bits (283), Expect = 2e-23 Identities = 54/80 (67%), Positives = 62/80 (77%) Frame = +3 Query: 45 RSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLCDG 224 RS+ VRA+ Q+ +SS +N IRK EKVVD V V ++SKP TAYCRCW S TFPLCDG Sbjct: 549 RSVRVRAQVQEGEASSVVLNPSIRKDVEKVVDTVVVGEISKPVTAYCRCWRSGTFPLCDG 608 Query: 225 THAKHNKETGDNVGPLLLKK 284 +H KHNK TGDNVGPLLLKK Sbjct: 609 SHMKHNKATGDNVGPLLLKK 628 >ref|XP_001779929.1| predicted protein [Physcomitrella patens] gi|162668643|gb|EDQ55246.1| predicted protein [Physcomitrella patens] Length = 86 Score = 113 bits (283), Expect = 2e-23 Identities = 55/82 (67%), Positives = 63/82 (76%), Gaps = 1/82 (1%) Frame = +3 Query: 42 RRSMVVRAEEQQAGSSSST-INKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLC 218 R S+ VRAE + ++SS IN IRK +KVVD V D+LSKP TAYCRCW S+TFPLC Sbjct: 5 RVSLAVRAEAAETTTASSAPINPSIRKDSDKVVDTVQADELSKPLTAYCRCWRSETFPLC 64 Query: 219 DGTHAKHNKETGDNVGPLLLKK 284 +G H KHNKETGDNVGPLLLKK Sbjct: 65 NGAHVKHNKETGDNVGPLLLKK 86 >ref|XP_002318867.1| hypothetical protein POPTR_0012s14230g [Populus trichocarpa] gi|222859540|gb|EEE97087.1| hypothetical protein POPTR_0012s14230g [Populus trichocarpa] Length = 107 Score = 112 bits (281), Expect = 4e-23 Identities = 58/83 (69%), Positives = 61/83 (73%) Frame = +3 Query: 42 RRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLCD 221 R +VVRAE Q IN IRKTEEKVVD V V +LSKP TAYCRCW S TFPLCD Sbjct: 31 RSLVVVRAEAQ-------AINPEIRKTEEKVVDSVMVAELSKPLTAYCRCWRSGTFPLCD 83 Query: 222 GTHAKHNKETGDNVGPLLLKKNK 290 G+H KHNK TGDNVGPLLLKK K Sbjct: 84 GSHVKHNKATGDNVGPLLLKKQK 106 >ref|XP_006490265.1| PREDICTED: CDGSH iron-sulfur domain-containing protein NEET-like [Citrus sinensis] Length = 130 Score = 112 bits (280), Expect = 5e-23 Identities = 58/81 (71%), Positives = 61/81 (75%) Frame = +3 Query: 42 RRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLCD 221 RR +VVRAE Q IN IRKTEEKVVD V V +LSKP TAYCRCW S TFPLCD Sbjct: 56 RRVVVVRAEGQG-------INLDIRKTEEKVVDSVVVTELSKPLTAYCRCWRSGTFPLCD 108 Query: 222 GTHAKHNKETGDNVGPLLLKK 284 G+H KHNK TGDNVGPLLLKK Sbjct: 109 GSHVKHNKATGDNVGPLLLKK 129 >ref|XP_006421772.1| hypothetical protein CICLE_v10006560mg, partial [Citrus clementina] gi|557523645|gb|ESR35012.1| hypothetical protein CICLE_v10006560mg, partial [Citrus clementina] Length = 198 Score = 112 bits (280), Expect = 5e-23 Identities = 58/81 (71%), Positives = 61/81 (75%) Frame = +3 Query: 42 RRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLCD 221 RR +VVRAE Q IN IRKTEEKVVD V V +LSKP TAYCRCW S TFPLCD Sbjct: 124 RRVVVVRAEGQG-------INLDIRKTEEKVVDSVVVTELSKPLTAYCRCWRSGTFPLCD 176 Query: 222 GTHAKHNKETGDNVGPLLLKK 284 G+H KHNK TGDNVGPLLLKK Sbjct: 177 GSHVKHNKATGDNVGPLLLKK 197 >ref|XP_004506290.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2A-like [Cicer arietinum] Length = 122 Score = 112 bits (280), Expect = 5e-23 Identities = 58/93 (62%), Positives = 64/93 (68%) Frame = +3 Query: 6 SIGIANAKSKGVRRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYC 185 S GI K VR +VV+AE S IN IRK EEKVVD V V++LSKP T YC Sbjct: 34 SFGIGGVDVKRVRSMVVVKAETGGVNS----INPDIRKNEEKVVDSVLVNELSKPLTPYC 89 Query: 186 RCWLSKTFPLCDGTHAKHNKETGDNVGPLLLKK 284 RCW S TFPLCDG+H KHNK TGDNVGPLL+KK Sbjct: 90 RCWRSGTFPLCDGSHVKHNKATGDNVGPLLVKK 122 >emb|CBI24493.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 111 bits (278), Expect = 9e-23 Identities = 57/87 (65%), Positives = 63/87 (72%) Frame = +3 Query: 24 AKSKGVRRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSK 203 + S RR++VVRAE TIN IRK EEKVVD V V +L+KP TAYCRCW S Sbjct: 20 SSSGAARRAVVVRAE---------TINPEIRKIEEKVVDSVLVAELAKPVTAYCRCWRSG 70 Query: 204 TFPLCDGTHAKHNKETGDNVGPLLLKK 284 TFPLCDG+H KHNK TGDNVGPLLLKK Sbjct: 71 TFPLCDGSHVKHNKATGDNVGPLLLKK 97 >ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Vitis vinifera] Length = 117 Score = 111 bits (278), Expect = 9e-23 Identities = 57/87 (65%), Positives = 63/87 (72%) Frame = +3 Query: 24 AKSKGVRRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSK 203 + S RR++VVRAE TIN IRK EEKVVD V V +L+KP TAYCRCW S Sbjct: 40 SSSGAARRAVVVRAE---------TINPEIRKIEEKVVDSVLVAELAKPVTAYCRCWRSG 90 Query: 204 TFPLCDGTHAKHNKETGDNVGPLLLKK 284 TFPLCDG+H KHNK TGDNVGPLLLKK Sbjct: 91 TFPLCDGSHVKHNKATGDNVGPLLLKK 117 >gb|ABK20944.1| unknown [Picea sitchensis] Length = 107 Score = 111 bits (278), Expect = 9e-23 Identities = 50/70 (71%), Positives = 57/70 (81%) Frame = +3 Query: 75 QAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETG 254 +A + +TIN IRK EEKVVD VP+ +LSKP T YCRCW S+TFPLCDG+H KHNK TG Sbjct: 38 RAEGTPATINPSIRKNEEKVVDNVPIAELSKPITPYCRCWRSQTFPLCDGSHVKHNKATG 97 Query: 255 DNVGPLLLKK 284 DNVGPLLLKK Sbjct: 98 DNVGPLLLKK 107 >ref|XP_002321854.2| hypothetical protein POPTR_0015s14240g [Populus trichocarpa] gi|550322696|gb|EEF05981.2| hypothetical protein POPTR_0015s14240g [Populus trichocarpa] Length = 173 Score = 111 bits (277), Expect = 1e-22 Identities = 57/83 (68%), Positives = 61/83 (73%) Frame = +3 Query: 42 RRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLCD 221 R +VVRAE Q +IN IRK EEKVVD V V +LSKP TAYCRCW S TFPLCD Sbjct: 97 RSLVVVRAEAQ-------SINPEIRKNEEKVVDSVVVAELSKPLTAYCRCWRSGTFPLCD 149 Query: 222 GTHAKHNKETGDNVGPLLLKKNK 290 G+H KHNK TGDNVGPLLLKK K Sbjct: 150 GSHVKHNKATGDNVGPLLLKKQK 172 >ref|XP_001783842.1| predicted protein [Physcomitrella patens] gi|162664620|gb|EDQ51332.1| predicted protein [Physcomitrella patens] Length = 112 Score = 111 bits (277), Expect = 1e-22 Identities = 53/82 (64%), Positives = 63/82 (76%), Gaps = 1/82 (1%) Frame = +3 Query: 42 RRSMVVRAEEQQAGSSSST-INKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLC 218 R S+ VRAE + ++S+ IN IRK +KVVD V ++LSKP TAYCRCW S+TFPLC Sbjct: 31 RVSLAVRAEAPETSTASAAHINPSIRKDSDKVVDTVQANELSKPLTAYCRCWRSETFPLC 90 Query: 219 DGTHAKHNKETGDNVGPLLLKK 284 +G H KHNKETGDNVGPLLLKK Sbjct: 91 NGAHVKHNKETGDNVGPLLLKK 112 >ref|XP_002510894.1| conserved hypothetical protein [Ricinus communis] gi|223550009|gb|EEF51496.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 110 bits (275), Expect = 2e-22 Identities = 56/83 (67%), Positives = 59/83 (71%) Frame = +3 Query: 42 RRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLCD 221 RR + VRAE Q IN IRK EEKVVD V V +LSKP T YCRCW S TFPLCD Sbjct: 35 RRMIAVRAEAQG-------INPAIRKDEEKVVDSVMVAELSKPLTPYCRCWRSGTFPLCD 87 Query: 222 GTHAKHNKETGDNVGPLLLKKNK 290 G+H KHNK TGDNVGPLLLKK K Sbjct: 88 GSHVKHNKATGDNVGPLLLKKQK 110 >gb|AFK46198.1| unknown [Lotus japonicus] Length = 118 Score = 108 bits (271), Expect = 6e-22 Identities = 53/81 (65%), Positives = 61/81 (75%) Frame = +3 Query: 42 RRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLCD 221 RR ++V+AE + G IN IRKTE KVVD V + +L+KP TAYCRCW S TFPLCD Sbjct: 43 RRVVLVKAEAEGVG-----INPDIRKTEAKVVDSVVITELAKPLTAYCRCWRSGTFPLCD 97 Query: 222 GTHAKHNKETGDNVGPLLLKK 284 G+H KHNK TGDNVGPLLLKK Sbjct: 98 GSHVKHNKATGDNVGPLLLKK 118 >gb|ESW24382.1| hypothetical protein PHAVU_004G125800g [Phaseolus vulgaris] Length = 111 Score = 108 bits (270), Expect = 7e-22 Identities = 54/81 (66%), Positives = 61/81 (75%) Frame = +3 Query: 42 RRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLCD 221 RR M+V+AE + +IN IRK+EEKVVD V V +LSKP AYCRCW S TFPLCD Sbjct: 38 RRVMLVKAE-------AVSINPDIRKSEEKVVDSVVVTELSKPVNAYCRCWRSGTFPLCD 90 Query: 222 GTHAKHNKETGDNVGPLLLKK 284 G+H KHNK TGDNVGPLLLKK Sbjct: 91 GSHVKHNKATGDNVGPLLLKK 111 >gb|EPS66502.1| hypothetical protein M569_08279 [Genlisea aurea] Length = 99 Score = 108 bits (269), Expect = 9e-22 Identities = 54/81 (66%), Positives = 60/81 (74%) Frame = +3 Query: 42 RRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTFPLCD 221 RR++ VRAE +IN IRK+EEKVVD V V +L KP TAYCRCW S TFPLCD Sbjct: 27 RRTVAVRAE---------SINPDIRKSEEKVVDSVVVAELGKPVTAYCRCWRSGTFPLCD 77 Query: 222 GTHAKHNKETGDNVGPLLLKK 284 G+H KHNK TGDNVGPLLLKK Sbjct: 78 GSHVKHNKGTGDNVGPLLLKK 98 >gb|EMJ19796.1| hypothetical protein PRUPE_ppa013339mg [Prunus persica] Length = 128 Score = 107 bits (268), Expect = 1e-21 Identities = 54/85 (63%), Positives = 62/85 (72%) Frame = +3 Query: 30 SKGVRRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAYCRCWLSKTF 209 S+ ++ +VV+AE Q IN IRK+EEKVVD V V +LSKP T YCRCW S TF Sbjct: 50 SRRMKPMVVVKAEAQP-------INPEIRKSEEKVVDSVVVSELSKPLTVYCRCWRSGTF 102 Query: 210 PLCDGTHAKHNKETGDNVGPLLLKK 284 PLCDG+H KHNK TGDNVGPLLLKK Sbjct: 103 PLCDGSHVKHNKATGDNVGPLLLKK 127 >ref|XP_003563153.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Brachypodium distachyon] Length = 114 Score = 107 bits (268), Expect = 1e-21 Identities = 53/94 (56%), Positives = 61/94 (64%) Frame = +3 Query: 3 SSIGIANAKSKGVRRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAY 182 SS G + + R +V E +A + S IN IRK E KVVD V +LSKP T Y Sbjct: 21 SSAGPSGLRRSRACRGVVAVRAEAEAAAGGSGINPAIRKEEAKVVDTVLAGELSKPLTPY 80 Query: 183 CRCWLSKTFPLCDGTHAKHNKETGDNVGPLLLKK 284 CRCW S TFPLCDG+H KHNK TGDNVGPLL+KK Sbjct: 81 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLVKK 114 >ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycine max] gi|255628565|gb|ACU14627.1| unknown [Glycine max] Length = 113 Score = 107 bits (268), Expect = 1e-21 Identities = 55/94 (58%), Positives = 67/94 (71%) Frame = +3 Query: 3 SSIGIANAKSKGVRRSMVVRAEEQQAGSSSSTINKCIRKTEEKVVDQVPVDDLSKPTTAY 182 S +G+ ++ RR ++V+AE + +IN IRK+EEKVVD V V +LSKP T Y Sbjct: 30 SFVGVGGVRT---RRVVLVKAE-------AVSINPDIRKSEEKVVDSVVVTELSKPLTPY 79 Query: 183 CRCWLSKTFPLCDGTHAKHNKETGDNVGPLLLKK 284 CRCW S TFPLCDG+H KHNK TGDNVGPLLLKK Sbjct: 80 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 113