BLASTX nr result
ID: Ephedra25_contig00002602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00002602 (783 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270340.2| PREDICTED: uncharacterized protein LOC100232... 86 1e-14 gb|EOX96539.1| RNA-binding family protein isoform 2 [Theobroma c... 85 2e-14 gb|EOX96538.1| RNA-binding family protein isoform 1 [Theobroma c... 85 2e-14 gb|AAN77868.1| putative heterogeneous nuclear ribonucleoprotein ... 85 2e-14 ref|XP_002302501.2| hypothetical protein POPTR_0002s14050g [Popu... 84 4e-14 ref|XP_002526479.1| RNA binding protein, putative [Ricinus commu... 84 7e-14 ref|XP_006375182.1| hypothetical protein POPTR_0014s05040g [Popu... 83 1e-13 ref|XP_002326849.1| predicted protein [Populus trichocarpa] 83 1e-13 ref|XP_003636168.1| Heterogeneous nuclear ribonucleoprotein Q [M... 82 2e-13 gb|EXB38373.1| Heterogeneous nuclear ribonucleoprotein Q [Morus ... 81 4e-13 ref|XP_006354663.1| PREDICTED: heterogeneous nuclear ribonucleop... 81 4e-13 ref|XP_006354662.1| PREDICTED: heterogeneous nuclear ribonucleop... 81 4e-13 ref|XP_004515317.1| PREDICTED: nucleolin-like isoform X1 [Cicer ... 81 5e-13 ref|XP_006338909.1| PREDICTED: nucleolin-like isoform X3 [Solanu... 80 8e-13 ref|XP_006338907.1| PREDICTED: nucleolin-like isoform X1 [Solanu... 80 8e-13 ref|XP_006445454.1| hypothetical protein CICLE_v10018944mg [Citr... 80 8e-13 ref|XP_004248989.1| PREDICTED: uncharacterized protein LOC101259... 80 8e-13 ref|NP_001275825.1| RNA recognition motif protein 1 [Citrus sine... 80 8e-13 gb|EPS63657.1| hypothetical protein M569_11127, partial [Genlise... 79 2e-12 ref|XP_006583510.1| PREDICTED: nucleolin-like isoform X1 [Glycin... 79 2e-12 >ref|XP_002270340.2| PREDICTED: uncharacterized protein LOC100232913 [Vitis vinifera] gi|297734640|emb|CBI16691.3| unnamed protein product [Vitis vinifera] Length = 812 Score = 86.3 bits (212), Expect = 1e-14 Identities = 40/45 (88%), Positives = 45/45 (100%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ATEDDLRKVFSQVGEVT++RL+MNPQT+ Sbjct: 226 RRKRKEFEVFVGGLDKDATEDDLRKVFSQVGEVTEVRLMMNPQTK 270 >gb|EOX96539.1| RNA-binding family protein isoform 2 [Theobroma cacao] Length = 802 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ATEDD+RKVFSQVGEV D+RL+MNPQT+ Sbjct: 220 RRKRKEFEVFVGGLDKDATEDDIRKVFSQVGEVVDVRLMMNPQTK 264 >gb|EOX96538.1| RNA-binding family protein isoform 1 [Theobroma cacao] gi|508704644|gb|EOX96540.1| RNA-binding family protein isoform 1 [Theobroma cacao] Length = 808 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ATEDD+RKVFSQVGEV D+RL+MNPQT+ Sbjct: 220 RRKRKEFEVFVGGLDKDATEDDIRKVFSQVGEVVDVRLMMNPQTK 264 >gb|AAN77868.1| putative heterogeneous nuclear ribonucleoprotein [Vitis vinifera] Length = 342 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/45 (86%), Positives = 45/45 (100%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ATEDDL+KVFSQVGEVT++RL+MNPQT+ Sbjct: 25 RRKRKEFEVFVGGLDKDATEDDLKKVFSQVGEVTEVRLMMNPQTK 69 >ref|XP_002302501.2| hypothetical protein POPTR_0002s14050g [Populus trichocarpa] gi|550344986|gb|EEE81774.2| hypothetical protein POPTR_0002s14050g [Populus trichocarpa] Length = 784 Score = 84.3 bits (207), Expect = 4e-14 Identities = 38/45 (84%), Positives = 45/45 (100%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ATEDDLRK+FS+VGEVT++RL+MNPQT+ Sbjct: 204 RRKRKEFEVFVGGLDKDATEDDLRKIFSRVGEVTEVRLMMNPQTK 248 >ref|XP_002526479.1| RNA binding protein, putative [Ricinus communis] gi|223534154|gb|EEF35870.1| RNA binding protein, putative [Ricinus communis] Length = 784 Score = 83.6 bits (205), Expect = 7e-14 Identities = 38/45 (84%), Positives = 45/45 (100%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ATEDDLRKVF++VGEVT++RL+MNPQT+ Sbjct: 207 RRKRKEFEVFVGGLDKDATEDDLRKVFTRVGEVTEVRLMMNPQTK 251 >ref|XP_006375182.1| hypothetical protein POPTR_0014s05040g [Populus trichocarpa] gi|550323501|gb|ERP52979.1| hypothetical protein POPTR_0014s05040g [Populus trichocarpa] Length = 785 Score = 82.8 bits (203), Expect = 1e-13 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFE+FVGGLDK+ATEDDLRKVFS+VGEVT+ RL+MNPQT+ Sbjct: 204 RRKRKEFEIFVGGLDKDATEDDLRKVFSRVGEVTEARLMMNPQTK 248 >ref|XP_002326849.1| predicted protein [Populus trichocarpa] Length = 343 Score = 82.8 bits (203), Expect = 1e-13 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFE+FVGGLDK+ATEDDLRKVFS+VGEVT+ RL+MNPQT+ Sbjct: 26 RRKRKEFEIFVGGLDKDATEDDLRKVFSRVGEVTEARLMMNPQTK 70 >ref|XP_003636168.1| Heterogeneous nuclear ribonucleoprotein Q [Medicago truncatula] gi|355502103|gb|AES83306.1| Heterogeneous nuclear ribonucleoprotein Q [Medicago truncatula] Length = 824 Score = 82.4 bits (202), Expect = 2e-13 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ATEDDLRKVFS+VG VT++RL+MNPQT+ Sbjct: 209 RRKRKEFEVFVGGLDKDATEDDLRKVFSEVGVVTEVRLMMNPQTK 253 >gb|EXB38373.1| Heterogeneous nuclear ribonucleoprotein Q [Morus notabilis] Length = 791 Score = 81.3 bits (199), Expect = 4e-13 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ATE DLRKVFS VGEVT++RL+MNPQT+ Sbjct: 204 RRKRKEFEVFVGGLDKDATEGDLRKVFSAVGEVTEVRLMMNPQTK 248 >ref|XP_006354663.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform X2 [Solanum tuberosum] Length = 789 Score = 81.3 bits (199), Expect = 4e-13 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 R KRKEFE+F+GGLDK+A EDDLRK+FSQVGEVT++RLLMNPQT+ Sbjct: 204 RLKRKEFEIFIGGLDKDAVEDDLRKIFSQVGEVTEVRLLMNPQTK 248 >ref|XP_006354662.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform X1 [Solanum tuberosum] Length = 790 Score = 81.3 bits (199), Expect = 4e-13 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 R KRKEFE+F+GGLDK+A EDDLRK+FSQVGEVT++RLLMNPQT+ Sbjct: 204 RLKRKEFEIFIGGLDKDAVEDDLRKIFSQVGEVTEVRLLMNPQTK 248 >ref|XP_004515317.1| PREDICTED: nucleolin-like isoform X1 [Cicer arietinum] gi|502173391|ref|XP_004515318.1| PREDICTED: nucleolin-like isoform X2 [Cicer arietinum] Length = 799 Score = 80.9 bits (198), Expect = 5e-13 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ATEDDLRKVF +VG VT++RL+MNPQT+ Sbjct: 209 RRKRKEFEVFVGGLDKDATEDDLRKVFGEVGVVTEVRLMMNPQTK 253 >ref|XP_006338909.1| PREDICTED: nucleolin-like isoform X3 [Solanum tuberosum] gi|565343584|ref|XP_006338910.1| PREDICTED: nucleolin-like isoform X4 [Solanum tuberosum] Length = 785 Score = 80.1 bits (196), Expect = 8e-13 Identities = 36/45 (80%), Positives = 44/45 (97%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFE+FVGGLDK+ATE+DLRKVFS+VGE+T++RLLMN QT+ Sbjct: 201 RRKRKEFEIFVGGLDKDATEEDLRKVFSKVGEITEVRLLMNSQTK 245 >ref|XP_006338907.1| PREDICTED: nucleolin-like isoform X1 [Solanum tuberosum] gi|565343580|ref|XP_006338908.1| PREDICTED: nucleolin-like isoform X2 [Solanum tuberosum] Length = 786 Score = 80.1 bits (196), Expect = 8e-13 Identities = 36/45 (80%), Positives = 44/45 (97%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFE+FVGGLDK+ATE+DLRKVFS+VGE+T++RLLMN QT+ Sbjct: 201 RRKRKEFEIFVGGLDKDATEEDLRKVFSKVGEITEVRLLMNSQTK 245 >ref|XP_006445454.1| hypothetical protein CICLE_v10018944mg [Citrus clementina] gi|567905934|ref|XP_006445455.1| hypothetical protein CICLE_v10018944mg [Citrus clementina] gi|568819727|ref|XP_006464397.1| PREDICTED: nucleolin isoform X1 [Citrus sinensis] gi|568819729|ref|XP_006464398.1| PREDICTED: nucleolin isoform X2 [Citrus sinensis] gi|568819731|ref|XP_006464399.1| PREDICTED: nucleolin isoform X3 [Citrus sinensis] gi|557547716|gb|ESR58694.1| hypothetical protein CICLE_v10018944mg [Citrus clementina] gi|557547717|gb|ESR58695.1| hypothetical protein CICLE_v10018944mg [Citrus clementina] Length = 776 Score = 80.1 bits (196), Expect = 8e-13 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ DDLRKVFSQVGEVT++RL+MNPQT+ Sbjct: 191 RRKRKEFEVFVGGLDKDVVGDDLRKVFSQVGEVTEVRLMMNPQTK 235 >ref|XP_004248989.1| PREDICTED: uncharacterized protein LOC101259595 [Solanum lycopersicum] Length = 769 Score = 80.1 bits (196), Expect = 8e-13 Identities = 36/45 (80%), Positives = 44/45 (97%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFE+FVGGLDK+ATE+DLRKVFS+VGE+T++RLLMN QT+ Sbjct: 185 RRKRKEFEIFVGGLDKDATEEDLRKVFSKVGEITEVRLLMNSQTK 229 >ref|NP_001275825.1| RNA recognition motif protein 1 [Citrus sinensis] gi|567905936|ref|XP_006445456.1| hypothetical protein CICLE_v10018944mg [Citrus clementina] gi|568819733|ref|XP_006464400.1| PREDICTED: nucleolin isoform X4 [Citrus sinensis] gi|359386142|gb|AEV43360.1| RNA recognition motif protein 1 [Citrus sinensis] gi|557547718|gb|ESR58696.1| hypothetical protein CICLE_v10018944mg [Citrus clementina] Length = 775 Score = 80.1 bits (196), Expect = 8e-13 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ DDLRKVFSQVGEVT++RL+MNPQT+ Sbjct: 191 RRKRKEFEVFVGGLDKDVVGDDLRKVFSQVGEVTEVRLMMNPQTK 235 >gb|EPS63657.1| hypothetical protein M569_11127, partial [Genlisea aurea] Length = 755 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFE+FVGGLDK+ATE DLRKVFS+VGEVT++RL+MN QT+ Sbjct: 201 RRKRKEFEIFVGGLDKDATEGDLRKVFSEVGEVTEVRLMMNAQTK 245 >ref|XP_006583510.1| PREDICTED: nucleolin-like isoform X1 [Glycine max] gi|571465910|ref|XP_006583511.1| PREDICTED: nucleolin-like isoform X2 [Glycine max] Length = 819 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 136 RRKRKEFEVFVGGLDKEATEDDLRKVFSQVGEVTDIRLLMNPQTQ 2 RRKRKEFEVFVGGLDK+ATE DLRKVF +VG VT++RL+MNPQT+ Sbjct: 229 RRKRKEFEVFVGGLDKDATESDLRKVFGEVGVVTEVRLMMNPQTK 273