BLASTX nr result
ID: Ephedra25_contig00002321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00002321 (442 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK22861.1| unknown [Picea sitchensis] gi|116791830|gb|ABK261... 62 1e-07 gb|AFG55749.1| hypothetical protein 0_12568_01 [Pinus taeda] 60 4e-07 gb|AFG55747.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|... 60 4e-07 >gb|ABK22861.1| unknown [Picea sitchensis] gi|116791830|gb|ABK26124.1| unknown [Picea sitchensis] Length = 137 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = -2 Query: 153 WEMHPIPWEVDLGMQRAFNGTMRNRRRLGTFKLCALCTCCGGHRRLCFPSP 1 WEM P P E + FN T RR+LGTF++C+LCTCCGG LC PSP Sbjct: 62 WEMRPFPSEASY---QIFNET---RRKLGTFQICSLCTCCGGRHHLCLPSP 106 >gb|AFG55749.1| hypothetical protein 0_12568_01 [Pinus taeda] Length = 95 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/51 (52%), Positives = 32/51 (62%) Frame = -2 Query: 153 WEMHPIPWEVDLGMQRAFNGTMRNRRRLGTFKLCALCTCCGGHRRLCFPSP 1 WEM P P E + N T RR+LGTF++C+LCTCCGG LC PSP Sbjct: 20 WEMRPFPSEASY---QVLNET---RRKLGTFQICSLCTCCGGRHHLCLPSP 64 >gb|AFG55747.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|383147968|gb|AFG55748.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|383147972|gb|AFG55750.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|383147974|gb|AFG55751.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|383147976|gb|AFG55752.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|383147978|gb|AFG55753.1| hypothetical protein 0_12568_01 [Pinus taeda] Length = 95 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/51 (52%), Positives = 32/51 (62%) Frame = -2 Query: 153 WEMHPIPWEVDLGMQRAFNGTMRNRRRLGTFKLCALCTCCGGHRRLCFPSP 1 WEM P P E + N T RR+LGTF++C+LCTCCGG LC PSP Sbjct: 20 WEMRPFPSEASY---QVLNET---RRKLGTFQICSLCTCCGGRHHLCLPSP 64