BLASTX nr result
ID: Ephedra25_contig00001964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00001964 (591 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315172.1| Eukaryotic translation initiation factor 3 s... 60 3e-07 ref|XP_006355662.1| PREDICTED: eukaryotic translation initiation... 58 2e-06 ref|XP_002526864.1| eukaryotic translation initiation factor 3f,... 58 2e-06 ref|XP_006842532.1| hypothetical protein AMTR_s00077p00121720 [A... 58 2e-06 ref|XP_004138431.1| PREDICTED: eukaryotic translation initiation... 58 2e-06 gb|ABK26006.1| unknown [Picea sitchensis] 58 2e-06 ref|XP_004239934.1| PREDICTED: eukaryotic translation initiation... 57 3e-06 gb|EXB58177.1| Eukaryotic translation initiation factor 3 subuni... 57 4e-06 ref|XP_006435688.1| hypothetical protein CICLE_v10032098mg [Citr... 56 6e-06 ref|XP_006435687.1| hypothetical protein CICLE_v10032098mg [Citr... 56 6e-06 ref|XP_006435686.1| hypothetical protein CICLE_v10032098mg [Citr... 56 6e-06 ref|NP_001275804.1| putative eukaryotic translation initiation f... 56 8e-06 gb|AAL15890.1|AF417302_1 26S proteasome regulatory subunit S12 i... 56 8e-06 >ref|XP_002315172.1| Eukaryotic translation initiation factor 3 subunit 5 family protein [Populus trichocarpa] gi|118484603|gb|ABK94175.1| unknown [Populus trichocarpa] gi|222864212|gb|EEF01343.1| Eukaryotic translation initiation factor 3 subunit 5 family protein [Populus trichocarpa] Length = 287 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/55 (52%), Positives = 38/55 (69%) Frame = +3 Query: 345 FDPREV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 F REV NPIH+T++T IK Y+++ LS GDRPL AQF++VPLDL +E Sbjct: 120 FYSREVPNPIHLTVDTGFSNGEGTIKAYVSVNLSLGDRPLAAQFQEVPLDLRMVE 174 >ref|XP_006355662.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Solanum tuberosum] Length = 285 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/57 (47%), Positives = 39/57 (68%) Frame = +3 Query: 339 QRFDPREV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 Q F RE NPIH+T++T Q IK ++++ LS GD+PL AQF+++PLDL +E Sbjct: 116 QEFYSRETSNPIHLTVDTGFQNGEASIKGFVSVHLSLGDQPLAAQFQEIPLDLRMVE 172 >ref|XP_002526864.1| eukaryotic translation initiation factor 3f, eif3f, putative [Ricinus communis] gi|223533763|gb|EEF35495.1| eukaryotic translation initiation factor 3f, eif3f, putative [Ricinus communis] Length = 287 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = +3 Query: 345 FDPREV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 F REV NP+H+T++T + IK Y+++ LS GDR L AQF+++PLDL LE Sbjct: 120 FYSREVPNPVHLTVDTGFRNGEGTIKAYVSVNLSLGDRQLAAQFQEIPLDLRMLE 174 >ref|XP_006842532.1| hypothetical protein AMTR_s00077p00121720 [Amborella trichopoda] gi|548844618|gb|ERN04207.1| hypothetical protein AMTR_s00077p00121720 [Amborella trichopoda] Length = 284 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = +3 Query: 345 FDPREV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 F REV NP+H+T++T + IK Y+ + LS GDR L AQF++VPLDL LE Sbjct: 117 FYSREVANPVHLTVDTGFSSGEASIKAYVGVNLSVGDRQLAAQFQEVPLDLRMLE 171 >ref|XP_004138431.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Cucumis sativus] gi|449517876|ref|XP_004165970.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Cucumis sativus] Length = 285 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = +3 Query: 345 FDPREV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 F REV NPIH+T++T + IK YI++ LS GDR L AQF+++PLDL +E Sbjct: 118 FYSREVANPIHLTVDTGFKNGEGTIKAYISVNLSLGDRQLAAQFQEIPLDLRMVE 172 >gb|ABK26006.1| unknown [Picea sitchensis] Length = 284 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/57 (47%), Positives = 39/57 (68%) Frame = +3 Query: 339 QRFDPREV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 Q F REV NP+H+T++TS ++ IK Y++ +S GDR L AQF ++PLDL +E Sbjct: 115 QDFYAREVTNPVHLTVDTSFLNEQATIKAYVSTTISLGDRQLAAQFHEIPLDLRMVE 171 >ref|XP_004239934.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Solanum lycopersicum] Length = 285 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/57 (47%), Positives = 39/57 (68%) Frame = +3 Query: 339 QRFDPREV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 Q F RE NPIH+T++T Q IK ++++ LS GD+PL AQF+++PLDL +E Sbjct: 116 QEFYSRESSNPIHLTVDTGFQNGEASIKGFVSVHLSLGDQPLAAQFQEIPLDLRMVE 172 >gb|EXB58177.1| Eukaryotic translation initiation factor 3 subunit F [Morus notabilis] Length = 215 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/60 (43%), Positives = 39/60 (65%) Frame = +3 Query: 330 QVEQRFDPREV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 Q+ F REV NP+H+T++T IK Y+++ LS GDR + AQF+++PLDL +E Sbjct: 96 QLIHEFYSREVPNPVHLTVDTGFNNGEGTIKAYVSVNLSLGDRQIAAQFQEIPLDLRMVE 155 >ref|XP_006435688.1| hypothetical protein CICLE_v10032098mg [Citrus clementina] gi|567886334|ref|XP_006435689.1| hypothetical protein CICLE_v10032098mg [Citrus clementina] gi|557537884|gb|ESR48928.1| hypothetical protein CICLE_v10032098mg [Citrus clementina] gi|557537885|gb|ESR48929.1| hypothetical protein CICLE_v10032098mg [Citrus clementina] Length = 327 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/52 (46%), Positives = 37/52 (71%) Frame = +3 Query: 354 REV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 REV NP+H+T++T + +K Y+++ LS GDR L AQF+++PLDL +E Sbjct: 163 REVPNPVHLTVDTGFRNGEGTVKAYVSVNLSLGDRQLAAQFQEIPLDLRMIE 214 >ref|XP_006435687.1| hypothetical protein CICLE_v10032098mg [Citrus clementina] gi|557537883|gb|ESR48927.1| hypothetical protein CICLE_v10032098mg [Citrus clementina] Length = 262 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/52 (46%), Positives = 37/52 (71%) Frame = +3 Query: 354 REV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 REV NP+H+T++T + +K Y+++ LS GDR L AQF+++PLDL +E Sbjct: 163 REVPNPVHLTVDTGFRNGEGTVKAYVSVNLSLGDRQLAAQFQEIPLDLRMIE 214 >ref|XP_006435686.1| hypothetical protein CICLE_v10032098mg [Citrus clementina] gi|557537882|gb|ESR48926.1| hypothetical protein CICLE_v10032098mg [Citrus clementina] Length = 230 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/52 (46%), Positives = 37/52 (71%) Frame = +3 Query: 354 REV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 REV NP+H+T++T + +K Y+++ LS GDR L AQF+++PLDL +E Sbjct: 163 REVPNPVHLTVDTGFRNGEGTVKAYVSVNLSLGDRQLAAQFQEIPLDLRMIE 214 >ref|NP_001275804.1| putative eukaryotic translation initiation factor 1 [Citrus sinensis] gi|260586249|gb|ACX45995.1| putative eukaryotic translation initiation factor 1 [Citrus sinensis] Length = 288 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/52 (46%), Positives = 36/52 (69%) Frame = +3 Query: 354 REV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 REV NP+H+T+ T + +K Y+++ LS GDR L AQF+++PLDL +E Sbjct: 124 REVPNPVHLTVGTGFRNGEGTVKAYVSVNLSLGDRQLAAQFQEIPLDLRMIE 175 >gb|AAL15890.1|AF417302_1 26S proteasome regulatory subunit S12 isolog-like protein [Castanea sativa] Length = 197 Score = 55.8 bits (133), Expect = 8e-06 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = +3 Query: 345 FDPREV*NPIHITLNTSLQTKRHPIKVYIAILLSFGDRPLLAQFKKVPLDL*FLE 509 F REV NPIH+T++T IK Y++ LS GDR L AQF++VPLDL +E Sbjct: 42 FYSREVPNPIHLTVDTGFNNGEGTIKAYVSANLSLGDRQLAAQFQEVPLDLRMVE 96