BLASTX nr result
ID: Ephedra25_contig00001038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00001038 (523 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001043738.1| Os01g0652600 [Oryza sativa Japonica Group] g... 70 3e-10 gb|EAY75202.1| hypothetical protein OsI_03093 [Oryza sativa Indi... 70 3e-10 gb|EAZ12924.1| hypothetical protein OsJ_02845 [Oryza sativa Japo... 70 3e-10 gb|ACG35752.1| ketol-acid reductoisomerase [Zea mays] 70 4e-10 ref|NP_191420.1| ketol-acid reductoisomerase [Arabidopsis thalia... 69 5e-10 ref|XP_006654822.1| PREDICTED: ketol-acid reductoisomerase, chlo... 69 5e-10 ref|XP_006644446.1| PREDICTED: ketol-acid reductoisomerase, chlo... 69 5e-10 ref|XP_006377362.1| hypothetical protein POPTR_0011s05250g [Popu... 69 5e-10 ref|XP_004969335.1| PREDICTED: ketol-acid reductoisomerase, chlo... 69 5e-10 ref|XP_006290799.1| hypothetical protein CARUB_v10016904mg [Caps... 69 5e-10 gb|EMT12226.1| Ketol-acid reductoisomerase, chloroplastic [Aegil... 69 5e-10 ref|XP_003567849.1| PREDICTED: ketol-acid reductoisomerase, chlo... 69 5e-10 dbj|BAJ92898.1| predicted protein [Hordeum vulgare subsp. vulgare] 69 5e-10 dbj|BAJ89855.1| predicted protein [Hordeum vulgare subsp. vulgare] 69 5e-10 ref|XP_002876470.1| ketol-acid reductoisomerase [Arabidopsis lyr... 69 5e-10 ref|XP_002456065.1| hypothetical protein SORBIDRAFT_03g029720 [S... 69 5e-10 ref|XP_002329780.1| predicted protein [Populus trichocarpa] 69 5e-10 dbj|BAH20088.1| AT3G58610 [Arabidopsis thaliana] 69 5e-10 ref|NP_001132259.1| ketol-acid reductoisomerase [Zea mays] gi|19... 69 5e-10 dbj|BAD94384.1| ketol-acid reductoisomerase [Arabidopsis thaliana] 69 5e-10 >ref|NP_001043738.1| Os01g0652600 [Oryza sativa Japonica Group] gi|55297085|dbj|BAD68706.1| putative ketol-acid reductoisomerase precursor [Oryza sativa Japonica Group] gi|113533269|dbj|BAF05652.1| Os01g0652600 [Oryza sativa Japonica Group] Length = 548 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNFFSD VH A+EVCA LRPTVDI+V ADADFVRPELRQ Sbjct: 508 SNFFSDPVHSAIEVCAQLRPTVDISVPADADFVRPELRQ 546 >gb|EAY75202.1| hypothetical protein OsI_03093 [Oryza sativa Indica Group] Length = 703 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNFFSD VH A+EVCA LRPTVDI+V ADADFVRPELRQ Sbjct: 663 SNFFSDPVHSAIEVCAQLRPTVDISVPADADFVRPELRQ 701 >gb|EAZ12924.1| hypothetical protein OsJ_02845 [Oryza sativa Japonica Group] Length = 581 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNFFSD VH A+EVCA LRPTVDI+V ADADFVRPELRQ Sbjct: 541 SNFFSDPVHSAIEVCAQLRPTVDISVPADADFVRPELRQ 579 >gb|ACG35752.1| ketol-acid reductoisomerase [Zea mays] Length = 579 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNF SD VH A+EVCA LRPTVDI+VTADADFVRPELRQ Sbjct: 539 SNFMSDPVHDAIEVCAQLRPTVDISVTADADFVRPELRQ 577 >ref|NP_191420.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|145332887|ref|NP_001078309.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|334186086|ref|NP_001190127.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|12644387|sp|Q05758.2|ILV5_ARATH RecName: Full=Ketol-acid reductoisomerase, chloroplastic; AltName: Full=Acetohydroxy-acid reductoisomerase; AltName: Full=Alpha-keto-beta-hydroxylacyl reductoisomerase; Flags: Precursor gi|11692838|gb|AAG40022.1|AF324671_1 AT3g58610 [Arabidopsis thaliana] gi|11993867|gb|AAG42917.1|AF329500_1 putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|402552|emb|CAA49506.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|6735378|emb|CAB68199.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|17063195|gb|AAL32973.1| AT3g58610/F14P22_200 [Arabidopsis thaliana] gi|17529224|gb|AAL38839.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|20465493|gb|AAM20206.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|23397061|gb|AAN31816.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gi|23463055|gb|AAN33197.1| At3g58610/F14P22_200 [Arabidopsis thaliana] gi|332646283|gb|AEE79804.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|332646284|gb|AEE79805.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gi|332646285|gb|AEE79806.1| ketol-acid reductoisomerase [Arabidopsis thaliana] Length = 591 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNFFSD VH A+EVCA LRPTVDI+V ADADFVRPELRQ Sbjct: 550 SNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQ 588 >ref|XP_006654822.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Oryza brachyantha] Length = 514 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNF SD VH A+EVCA LRPTVDI+VTADADFVRPELRQ Sbjct: 474 SNFMSDPVHGAIEVCAQLRPTVDISVTADADFVRPELRQ 512 >ref|XP_006644446.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Oryza brachyantha] Length = 576 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNFFSD VH A+EVCA LRPTVDI+V ADADFVRPELRQ Sbjct: 536 SNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQ 574 >ref|XP_006377362.1| hypothetical protein POPTR_0011s05250g [Populus trichocarpa] gi|550327651|gb|ERP55159.1| hypothetical protein POPTR_0011s05250g [Populus trichocarpa] Length = 588 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNFFSD VH A+EVCA LRPTVDI+V ADADFVRPELRQ Sbjct: 547 SNFFSDPVHGAVEVCAQLRPTVDISVPADADFVRPELRQ 585 >ref|XP_004969335.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Setaria italica] Length = 581 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNF SD VH A+EVCA LRPTVDI+VTADADFVRPELRQ Sbjct: 541 SNFMSDPVHGAIEVCAQLRPTVDISVTADADFVRPELRQ 579 >ref|XP_006290799.1| hypothetical protein CARUB_v10016904mg [Capsella rubella] gi|482559506|gb|EOA23697.1| hypothetical protein CARUB_v10016904mg [Capsella rubella] Length = 591 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNFFSD VH A+EVCA LRPTVDI+V ADADFVRPELRQ Sbjct: 550 SNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQ 588 >gb|EMT12226.1| Ketol-acid reductoisomerase, chloroplastic [Aegilops tauschii] Length = 533 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNF SD VH A+EVCA LRPTVDI+VTADADFVRPELRQ Sbjct: 493 SNFMSDPVHGAIEVCAELRPTVDISVTADADFVRPELRQ 531 >ref|XP_003567849.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic-like [Brachypodium distachyon] Length = 581 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNF SD VH A+EVCA LRPTVDI+VTADADFVRPELRQ Sbjct: 541 SNFMSDPVHGAIEVCAELRPTVDISVTADADFVRPELRQ 579 >dbj|BAJ92898.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 577 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNF SD VH A+EVCA LRPTVDI+VTADADFVRPELRQ Sbjct: 537 SNFMSDPVHGAIEVCAELRPTVDISVTADADFVRPELRQ 575 >dbj|BAJ89855.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 577 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNF SD VH A+EVCA LRPTVDI+VTADADFVRPELRQ Sbjct: 537 SNFMSDPVHGAIEVCAELRPTVDISVTADADFVRPELRQ 575 >ref|XP_002876470.1| ketol-acid reductoisomerase [Arabidopsis lyrata subsp. lyrata] gi|297322308|gb|EFH52729.1| ketol-acid reductoisomerase [Arabidopsis lyrata subsp. lyrata] Length = 594 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNFFSD VH A+EVCA LRPTVDI+V ADADFVRPELRQ Sbjct: 553 SNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQ 591 >ref|XP_002456065.1| hypothetical protein SORBIDRAFT_03g029720 [Sorghum bicolor] gi|241928040|gb|EES01185.1| hypothetical protein SORBIDRAFT_03g029720 [Sorghum bicolor] Length = 579 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNF SD VH A+EVCA LRPTVDI+VTADADFVRPELRQ Sbjct: 539 SNFMSDPVHGAIEVCAQLRPTVDISVTADADFVRPELRQ 577 >ref|XP_002329780.1| predicted protein [Populus trichocarpa] Length = 525 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNFFSD VH A+EVCA LRPTVDI+V ADADFVRPELRQ Sbjct: 484 SNFFSDPVHGAVEVCAQLRPTVDISVPADADFVRPELRQ 522 >dbj|BAH20088.1| AT3G58610 [Arabidopsis thaliana] Length = 591 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNFFSD VH A+EVCA LRPTVDI+V ADADFVRPELRQ Sbjct: 550 SNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQ 588 >ref|NP_001132259.1| ketol-acid reductoisomerase [Zea mays] gi|194693902|gb|ACF81035.1| unknown [Zea mays] gi|414881183|tpg|DAA58314.1| TPA: ketol-acid reductoisomerase [Zea mays] Length = 579 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNF SD VH A+EVCA LRPTVDI+VTADADFVRPELRQ Sbjct: 539 SNFMSDPVHGAIEVCAQLRPTVDISVTADADFVRPELRQ 577 >dbj|BAD94384.1| ketol-acid reductoisomerase [Arabidopsis thaliana] Length = 344 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 SNFFSDSVHKAMEVCANLRPTVDIAVTADADFVRPELRQ 119 SNFFSD VH A+EVCA LRPTVDI+V ADADFVRPELRQ Sbjct: 303 SNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQ 341