BLASTX nr result
ID: Ephedra25_contig00000593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00000593 (401 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006383629.1| hypothetical protein POPTR_0005s21570g [Popu... 65 9e-09 gb|AAC14177.1| ABA stress ripening protein [Mesembryanthemum cry... 64 2e-08 ref|XP_002393977.1| hypothetical protein MPER_06206 [Moniliophth... 64 2e-08 gb|AFK81692.1| ABA and WDS induced 3 protein, partial [Pinus mugo] 64 2e-08 gb|AAB02692.1| LP3-1 [Pinus taeda] 64 3e-08 ref|XP_003579736.1| PREDICTED: uncharacterized protein LOC100822... 64 3e-08 gb|ADL28708.1| water-stress inducible protein 1 [Pinus pinaster]... 64 3e-08 gb|ADL28707.1| water-stress inducible protein 1 [Pinus pinaster]... 64 3e-08 gb|ADL28562.1| water-stress inducible protein 1 [Pinus halepensi... 64 3e-08 gb|ADL28512.1| water-stress inducible protein 1 [Pinus halepensi... 64 3e-08 gb|ADL28511.1| water-stress inducible protein 1 [Pinus halepensi... 64 3e-08 gb|AAR23420.1| ASR protein [Ginkgo biloba] 63 3e-08 gb|ABK26452.1| unknown [Picea sitchensis] gi|116792801|gb|ABK265... 62 6e-08 gb|ABK23128.1| unknown [Picea sitchensis] 62 6e-08 gb|ADK98522.1| hypothetical protein [Triticum aestivum] 62 8e-08 gb|EMT26478.1| Abscisic stress-ripening protein 2 [Aegilops taus... 62 8e-08 gb|EMS47440.1| Abscisic stress-ripening protein 2 [Triticum urartu] 62 8e-08 gb|AFK81697.1| ABA and WDS induced 3 protein, partial [Pinus mug... 62 8e-08 gb|AFK81669.1| ABA and WDS induced 3 protein, partial [Pinus mug... 62 8e-08 gb|ADA85716.1| ABA and WDS induced 3 protein [Pinus sylvestris] ... 62 8e-08 >ref|XP_006383629.1| hypothetical protein POPTR_0005s21570g [Populus trichocarpa] gi|550339462|gb|ERP61426.1| hypothetical protein POPTR_0005s21570g [Populus trichocarpa] Length = 136 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GELGT AAGAF+MHEKHE +KDPE AHRHK+EE I Sbjct: 64 VGELGTAAAGAFSMHEKHESKKDPEHAHRHKIEEEI 99 >gb|AAC14177.1| ABA stress ripening protein [Mesembryanthemum crystallinum] Length = 143 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 MGELG +AAGAFA+HEKH+ EKDPE AHRHK+EE I Sbjct: 70 MGELGAVAAGAFALHEKHKIEKDPEHAHRHKIEEEI 105 >ref|XP_002393977.1| hypothetical protein MPER_06206 [Moniliophthora perniciosa FA553] gi|215462261|gb|EEB94907.1| hypothetical protein MPER_06206 [Moniliophthora perniciosa FA553] Length = 112 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GELGT+AAGA+A+HEKH+E+KDPE AH+HK+EE I Sbjct: 39 LGELGTVAAGAYALHEKHKEKKDPEHAHKHKIEEEI 74 >gb|AFK81692.1| ABA and WDS induced 3 protein, partial [Pinus mugo] Length = 71 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +G +GT+AAGAFA+HEKH E+KDPERAHRHK+EE I Sbjct: 35 LGGVGTVAAGAFALHEKHAEKKDPERAHRHKIEEEI 70 >gb|AAB02692.1| LP3-1 [Pinus taeda] Length = 126 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GE+GT+AAGAFA+HEKH ++KDPE AHRHK+EE + Sbjct: 53 LGEMGTVAAGAFALHEKHADKKDPEHAHRHKIEEEV 88 >ref|XP_003579736.1| PREDICTED: uncharacterized protein LOC100822602 [Brachypodium distachyon] Length = 240 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GE+GTLAAGAFAM+EKH+ +KDPE AHRHK+EE + Sbjct: 160 LGEMGTLAAGAFAMYEKHQAKKDPENAHRHKIEEEV 195 >gb|ADL28708.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373080|gb|ADL28712.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373162|gb|ADL28753.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373184|gb|ADL28764.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373230|gb|ADL28787.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373232|gb|ADL28788.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373244|gb|ADL28794.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373246|gb|ADL28795.1| water-stress inducible protein 1 [Pinus pinaster] Length = 116 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GE+GT+AAGAFA+HEKH ++KDPE AHRHK+EE + Sbjct: 52 LGEMGTVAAGAFALHEKHADKKDPEHAHRHKIEEEV 87 >gb|ADL28707.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373074|gb|ADL28709.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373076|gb|ADL28710.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373078|gb|ADL28711.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373082|gb|ADL28713.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373084|gb|ADL28714.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373086|gb|ADL28715.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373088|gb|ADL28716.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373090|gb|ADL28717.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373092|gb|ADL28718.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373094|gb|ADL28719.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373096|gb|ADL28720.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373098|gb|ADL28721.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373100|gb|ADL28722.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373102|gb|ADL28723.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373104|gb|ADL28724.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373106|gb|ADL28725.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373108|gb|ADL28726.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373110|gb|ADL28727.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373112|gb|ADL28728.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373114|gb|ADL28729.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373116|gb|ADL28730.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373118|gb|ADL28731.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373120|gb|ADL28732.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373122|gb|ADL28733.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373124|gb|ADL28734.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373126|gb|ADL28735.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373128|gb|ADL28736.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373130|gb|ADL28737.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373132|gb|ADL28738.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373134|gb|ADL28739.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373136|gb|ADL28740.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373138|gb|ADL28741.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373140|gb|ADL28742.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373142|gb|ADL28743.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373144|gb|ADL28744.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373146|gb|ADL28745.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373148|gb|ADL28746.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373150|gb|ADL28747.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373152|gb|ADL28748.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373154|gb|ADL28749.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373156|gb|ADL28750.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373158|gb|ADL28751.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373160|gb|ADL28752.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373164|gb|ADL28754.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373166|gb|ADL28755.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373168|gb|ADL28756.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373170|gb|ADL28757.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373172|gb|ADL28758.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373174|gb|ADL28759.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373176|gb|ADL28760.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373178|gb|ADL28761.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373180|gb|ADL28762.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373182|gb|ADL28763.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373186|gb|ADL28765.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373188|gb|ADL28766.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373190|gb|ADL28767.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373192|gb|ADL28768.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373194|gb|ADL28769.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373196|gb|ADL28770.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373198|gb|ADL28771.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373200|gb|ADL28772.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373202|gb|ADL28773.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373204|gb|ADL28774.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373206|gb|ADL28775.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373208|gb|ADL28776.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373210|gb|ADL28777.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373212|gb|ADL28778.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373214|gb|ADL28779.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373216|gb|ADL28780.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373218|gb|ADL28781.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373220|gb|ADL28782.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373222|gb|ADL28783.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373224|gb|ADL28784.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373226|gb|ADL28785.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373228|gb|ADL28786.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373234|gb|ADL28789.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373236|gb|ADL28790.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373238|gb|ADL28791.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373240|gb|ADL28792.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373242|gb|ADL28793.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373248|gb|ADL28796.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373250|gb|ADL28797.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373252|gb|ADL28798.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373254|gb|ADL28799.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373256|gb|ADL28800.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373258|gb|ADL28801.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373260|gb|ADL28802.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373262|gb|ADL28803.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373264|gb|ADL28804.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373266|gb|ADL28805.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373268|gb|ADL28806.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373270|gb|ADL28807.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373272|gb|ADL28808.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373274|gb|ADL28809.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373276|gb|ADL28810.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373278|gb|ADL28811.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373280|gb|ADL28812.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373282|gb|ADL28813.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373284|gb|ADL28814.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373286|gb|ADL28815.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373288|gb|ADL28816.1| water-stress inducible protein 1 [Pinus pinaster] gi|302373290|gb|ADL28817.1| water-stress inducible protein 1 [Pinus pinaster] Length = 116 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GE+GT+AAGAFA+HEKH ++KDPE AHRHK+EE + Sbjct: 52 LGEMGTVAAGAFALHEKHADKKDPEHAHRHKIEEEV 87 >gb|ADL28562.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372784|gb|ADL28564.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372788|gb|ADL28566.1| water-stress inducible protein 1 [Pinus halepensis] Length = 100 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GE+GT+AAGAFA+HEKH ++KDPE AHRHK+EE + Sbjct: 52 LGEMGTVAAGAFALHEKHADKKDPEHAHRHKIEEEV 87 >gb|ADL28512.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372684|gb|ADL28514.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372688|gb|ADL28516.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372690|gb|ADL28517.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372692|gb|ADL28518.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372700|gb|ADL28522.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372704|gb|ADL28524.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372712|gb|ADL28528.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372716|gb|ADL28530.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372718|gb|ADL28531.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372720|gb|ADL28532.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372722|gb|ADL28533.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372726|gb|ADL28535.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372728|gb|ADL28536.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372730|gb|ADL28537.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372732|gb|ADL28538.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372734|gb|ADL28539.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372736|gb|ADL28540.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372738|gb|ADL28541.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372740|gb|ADL28542.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372742|gb|ADL28543.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372744|gb|ADL28544.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372746|gb|ADL28545.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372748|gb|ADL28546.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372758|gb|ADL28551.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372764|gb|ADL28554.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372766|gb|ADL28555.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372770|gb|ADL28557.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372772|gb|ADL28558.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372774|gb|ADL28559.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372776|gb|ADL28560.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372778|gb|ADL28561.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372782|gb|ADL28563.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372786|gb|ADL28565.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372790|gb|ADL28567.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372792|gb|ADL28568.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372794|gb|ADL28569.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372796|gb|ADL28570.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372798|gb|ADL28571.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372800|gb|ADL28572.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372802|gb|ADL28573.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372804|gb|ADL28574.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372806|gb|ADL28575.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372808|gb|ADL28576.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372810|gb|ADL28577.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372812|gb|ADL28578.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372816|gb|ADL28580.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372818|gb|ADL28581.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372820|gb|ADL28582.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372822|gb|ADL28583.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372824|gb|ADL28584.1| water-stress inducible protein 1 [Pinus halepensis] Length = 100 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GE+GT+AAGAFA+HEKH ++KDPE AHRHK+EE + Sbjct: 52 LGEMGTVAAGAFALHEKHADKKDPEHAHRHKIEEEV 87 >gb|ADL28511.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372682|gb|ADL28513.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372686|gb|ADL28515.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372694|gb|ADL28519.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372696|gb|ADL28520.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372698|gb|ADL28521.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372702|gb|ADL28523.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372706|gb|ADL28525.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372708|gb|ADL28526.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372710|gb|ADL28527.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372714|gb|ADL28529.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372724|gb|ADL28534.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372750|gb|ADL28547.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372752|gb|ADL28548.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372754|gb|ADL28549.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372756|gb|ADL28550.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372760|gb|ADL28552.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372762|gb|ADL28553.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372768|gb|ADL28556.1| water-stress inducible protein 1 [Pinus halepensis] gi|302372814|gb|ADL28579.1| water-stress inducible protein 1 [Pinus halepensis] Length = 100 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GE+GT+AAGAFA+HEKH ++KDPE AHRHK+EE + Sbjct: 52 LGEMGTVAAGAFALHEKHADKKDPEHAHRHKIEEEV 87 >gb|AAR23420.1| ASR protein [Ginkgo biloba] Length = 181 Score = 63.2 bits (152), Expect = 3e-08 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GELGT+AAGA+AM+EKHE +KDPE AHRHK+EE + Sbjct: 107 VGELGTMAAGAYAMYEKHEAKKDPEHAHRHKIEEEV 142 >gb|ABK26452.1| unknown [Picea sitchensis] gi|116792801|gb|ABK26505.1| unknown [Picea sitchensis] Length = 145 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 319 GELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 GELG AAGAFA+HEKH E+KDPE AHRHK+EE I Sbjct: 73 GELGAAAAGAFALHEKHAEKKDPEHAHRHKIEEEI 107 >gb|ABK23128.1| unknown [Picea sitchensis] Length = 145 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 319 GELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 GELG AAGAFA+HEKH E+KDPE AHRHK+EE I Sbjct: 73 GELGAAAAGAFALHEKHAEKKDPEHAHRHKIEEEI 107 >gb|ADK98522.1| hypothetical protein [Triticum aestivum] Length = 250 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GE+GTLA+GAFAM+EKH+ +KDPE AHRHK+EE + Sbjct: 168 LGEIGTLASGAFAMYEKHQVKKDPENAHRHKIEEEV 203 >gb|EMT26478.1| Abscisic stress-ripening protein 2 [Aegilops tauschii] Length = 207 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GE+GTLA+GAFAM+EKH+ +KDPE AHRHK+EE + Sbjct: 125 LGEIGTLASGAFAMYEKHQVKKDPENAHRHKIEEEV 160 >gb|EMS47440.1| Abscisic stress-ripening protein 2 [Triticum urartu] Length = 217 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +GE+GTLA+GAFAM+EKH+ +KDPE AHRHK+EE + Sbjct: 135 LGEIGTLASGAFAMYEKHQVKKDPENAHRHKIEEEV 170 >gb|AFK81697.1| ABA and WDS induced 3 protein, partial [Pinus mugo subsp. uncinata] Length = 71 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +G LGT+A GAFA+HEKH E+KDPE+AHRHK+EE I Sbjct: 35 LGGLGTVATGAFALHEKHAEKKDPEQAHRHKIEEEI 70 >gb|AFK81669.1| ABA and WDS induced 3 protein, partial [Pinus mugo] gi|388893745|gb|AFK81671.1| ABA and WDS induced 3 protein, partial [Pinus mugo] gi|388893749|gb|AFK81673.1| ABA and WDS induced 3 protein, partial [Pinus mugo] gi|388893753|gb|AFK81675.1| ABA and WDS induced 3 protein, partial [Pinus mugo] Length = 71 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +G +G +AAGAFA+HEKH E+KDPERAHRHK+EE I Sbjct: 35 LGGVGAVAAGAFALHEKHAEKKDPERAHRHKIEEEI 70 >gb|ADA85716.1| ABA and WDS induced 3 protein [Pinus sylvestris] gi|282767365|gb|ADA85717.1| ABA and WDS induced 3 protein [Pinus sylvestris] gi|282767383|gb|ADA85726.1| ABA and WDS induced 3 protein [Pinus sylvestris] gi|282767389|gb|ADA85729.1| ABA and WDS induced 3 protein [Pinus sylvestris] gi|282767399|gb|ADA85734.1| ABA and WDS induced 3 protein [Pinus sylvestris] gi|317544125|gb|ADV32523.1| ABA and WDS induced protein 3 [Pinus sylvestris] gi|317544143|gb|ADV32532.1| ABA and WDS induced protein 3 [Pinus sylvestris] gi|317544145|gb|ADV32533.1| ABA and WDS induced protein 3 [Pinus sylvestris] gi|317544147|gb|ADV32534.1| ABA and WDS induced protein 3 [Pinus sylvestris] gi|317544163|gb|ADV32542.1| ABA and WDS induced protein 3 [Pinus sylvestris] gi|317544181|gb|ADV32551.1| ABA and WDS induced protein 3 [Pinus sylvestris] gi|317544191|gb|ADV32556.1| ABA and WDS induced protein 3 [Pinus sylvestris] gi|317544193|gb|ADV32557.1| ABA and WDS induced protein 3 [Pinus sylvestris] gi|317544215|gb|ADV32568.1| ABA and WDS induced protein 3 [Pinus sylvestris] gi|317544253|gb|ADV32587.1| ABA and WDS induced protein 3 [Pinus sylvestris] Length = 77 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 322 MGELGTLAAGAFAMHEKHEEEKDPERAHRHKLEERI 215 +G LGT+A GAFA+HEKH E+KDPE+AHRHK+EE I Sbjct: 38 LGGLGTVATGAFALHEKHAEKKDPEQAHRHKIEEEI 73