BLASTX nr result
ID: Ephedra25_contig00000353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00000353 (510 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006662849.1| PREDICTED: chlorophyll a-b binding protein C... 59 7e-07 ref|NP_001105698.1| light harvesting chlorophyll a/b binding pro... 58 1e-06 ref|NP_001105374.1| chlorophyll a/b-binding apoprotein CP26 prec... 58 1e-06 tpg|DAA41881.1| TPA: hypothetical protein ZEAMMB73_898154 [Zea m... 58 1e-06 ref|XP_002450563.1| hypothetical protein SORBIDRAFT_05g007070 [S... 58 1e-06 gb|ACN36418.1| unknown [Zea mays] 58 1e-06 gb|ACF82848.1| unknown [Zea mays] 58 1e-06 gb|AAX95979.1| chlorophyll a/b-binding protein CP26 precursor - ... 57 2e-06 ref|NP_001067593.1| Os11g0242800 [Oryza sativa Japonica Group] g... 57 2e-06 gb|AAX95980.1| chlorophyll a/b-binding protein CP26 precursor - ... 57 2e-06 gb|ABX47017.1| chloroplast chlorophyll a/b binding protein cab-P... 57 2e-06 gb|EAY80485.1| hypothetical protein OsI_35663 [Oryza sativa Indi... 57 2e-06 gb|ABG22425.1| Chlorophyll A-B binding protein, expressed [Oryza... 57 2e-06 ref|XP_003577654.1| PREDICTED: chlorophyll a-b binding protein C... 57 3e-06 ref|XP_004978995.1| PREDICTED: chlorophyll a-b binding protein C... 57 3e-06 >ref|XP_006662849.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like [Oryza brachyantha] Length = 283 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = -3 Query: 160 KVVCLFGRXXXXXXXXXXXXXKVSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 K+V LFG+ V++SS DI DELAKWYGPDRR FLPEGLLD+ Sbjct: 33 KIVSLFGKKPAPKPKPAA----VTSSSPDIGDELAKWYGPDRRIFLPEGLLDR 81 >ref|NP_001105698.1| light harvesting chlorophyll a/b binding protein5 precursor [Zea mays] gi|733454|gb|AAA64414.1| chlorophyll a/b-binding apoprotein CP26 precursor [Zea mays] gi|414591311|tpg|DAA41882.1| TPA: chlorophyll a/b-binding apoprotein CP26 Precursor [Zea mays] Length = 283 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 VS+SS DISDELAKWYGPDRR +LP+GLLD+ Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDR 81 >ref|NP_001105374.1| chlorophyll a/b-binding apoprotein CP26 precursor [Zea mays] gi|733456|gb|AAA64415.1| chlorophyll a/b-binding apoprotein CP26 precursor [Zea mays] Length = 283 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 VS+SS DISDELAKWYGPDRR +LP+GLLD+ Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDR 81 >tpg|DAA41881.1| TPA: hypothetical protein ZEAMMB73_898154 [Zea mays] Length = 95 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 VS+SS DISDELAKWYGPDRR +LP+GLLD+ Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDR 81 >ref|XP_002450563.1| hypothetical protein SORBIDRAFT_05g007070 [Sorghum bicolor] gi|241936406|gb|EES09551.1| hypothetical protein SORBIDRAFT_05g007070 [Sorghum bicolor] Length = 282 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 VS+SS DISDELAKWYGPDRR +LP+GLLD+ Sbjct: 50 VSSSSPDISDELAKWYGPDRRIYLPDGLLDR 80 >gb|ACN36418.1| unknown [Zea mays] Length = 186 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 VS+SS DISDELAKWYGPDRR +LP+GLLD+ Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDR 81 >gb|ACF82848.1| unknown [Zea mays] Length = 283 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 VS+SS DISDELAKWYGPDRR +LP+GLLD+ Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDR 81 >gb|AAX95979.1| chlorophyll a/b-binding protein CP26 precursor - maize [Oryza sativa Japonica Group] gi|77549543|gb|ABA92340.1| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] Length = 225 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 V++SS DI DELAKWYGPDRR FLPEGLLD+ Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDR 81 >ref|NP_001067593.1| Os11g0242800 [Oryza sativa Japonica Group] gi|62733869|gb|AAX95978.1| chlorophyll a/b-binding protein CP26 precursor - maize [Oryza sativa Japonica Group] gi|108864184|gb|ABA92338.2| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] gi|113644815|dbj|BAF27956.1| Os11g0242800 [Oryza sativa Japonica Group] gi|125576735|gb|EAZ17957.1| hypothetical protein OsJ_33501 [Oryza sativa Japonica Group] gi|215692422|dbj|BAG87842.1| unnamed protein product [Oryza sativa Japonica Group] gi|215704351|dbj|BAG93785.1| unnamed protein product [Oryza sativa Japonica Group] Length = 283 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 V++SS DI DELAKWYGPDRR FLPEGLLD+ Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDR 81 >gb|AAX95980.1| chlorophyll a/b-binding protein CP26 precursor - maize [Oryza sativa Japonica Group] gi|108864187|gb|ABA92339.2| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] Length = 245 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 V++SS DI DELAKWYGPDRR FLPEGLLD+ Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDR 81 >gb|ABX47017.1| chloroplast chlorophyll a/b binding protein cab-PhE9 [Phyllostachys edulis] Length = 283 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 91 STSSSDISDELAKWYGPDRRTFLPEGLLDK 2 S+S SDI DELAKWYGPDRR FLPEGLLD+ Sbjct: 52 SSSGSDIGDELAKWYGPDRRIFLPEGLLDR 81 >gb|EAY80485.1| hypothetical protein OsI_35663 [Oryza sativa Indica Group] Length = 283 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 V++SS DI DELAKWYGPDRR FLPEGLLD+ Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDR 81 >gb|ABG22425.1| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] Length = 186 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 V++SS DI DELAKWYGPDRR FLPEGLLD+ Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDR 81 >ref|XP_003577654.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like [Brachypodium distachyon] Length = 286 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/53 (54%), Positives = 34/53 (64%) Frame = -3 Query: 160 KVVCLFGRXXXXXXXXXXXXXKVSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 K+V LFG VS+S +DI DELAKWYGPDRR FLP+GLLD+ Sbjct: 33 KIVSLFG-GFNKKPAAKPKPAPVSSSGADIDDELAKWYGPDRRIFLPDGLLDR 84 >ref|XP_004978995.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like [Setaria italica] Length = 283 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 94 VSTSSSDISDELAKWYGPDRRTFLPEGLLDK 2 V++SS DISDELAKWYGPDRR +LP+GLLD+ Sbjct: 51 VTSSSPDISDELAKWYGPDRRIYLPDGLLDR 81