BLASTX nr result
ID: Dioscorea21_contig00040134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00040134 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 emb|CAN63659.1| hypothetical protein VITISV_008415 [Vitis vinifera] 65 4e-09 ref|NP_179798.1| pentatricopeptide repeat-containing protein [Ar... 65 6e-09 ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 ref|XP_002878586.1| pentatricopeptide repeat-containing protein ... 63 3e-08 >ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] Length = 758 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/68 (45%), Positives = 45/68 (66%) Frame = -2 Query: 249 LLSACVIHGNVNVGRIAAKELEILKPGNARSYYALASVYKRAGKAEESKRVLDLIWNKEL 70 LLS+C +H NV++G +AA++L L+P N +Y L+++Y G E RV D++ NK L Sbjct: 561 LLSSCRVHNNVSLGEVAAEKLFELEPSNPGNYILLSNIYASKGMWNEVNRVRDMMKNKGL 620 Query: 69 RKNSGFSW 46 RKN G SW Sbjct: 621 RKNPGCSW 628 >emb|CAN63659.1| hypothetical protein VITISV_008415 [Vitis vinifera] Length = 760 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/68 (45%), Positives = 45/68 (66%) Frame = -2 Query: 249 LLSACVIHGNVNVGRIAAKELEILKPGNARSYYALASVYKRAGKAEESKRVLDLIWNKEL 70 LLS+C +H NV++G +AA++L L+P N +Y L+++Y G E RV D++ NK L Sbjct: 561 LLSSCRVHNNVSLGEVAAEKLFELEPSNPGNYILLSNIYASKGMWNEVNRVRDMMKNKGL 620 Query: 69 RKNSGFSW 46 RKN G SW Sbjct: 621 RKNPGCSW 628 >ref|NP_179798.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206010|sp|Q9SHZ8.1|PP168_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g22070 gi|4587589|gb|AAD25817.1| hypothetical protein [Arabidopsis thaliana] gi|330252165|gb|AEC07259.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 786 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/69 (40%), Positives = 49/69 (71%) Frame = -2 Query: 252 TLLSACVIHGNVNVGRIAAKELEILKPGNARSYYALASVYKRAGKAEESKRVLDLIWNKE 73 +LLSAC +H N+++G++AA+ L +L+P N+ +Y ALA++Y GK EE+ ++ + + Sbjct: 588 SLLSACRVHKNIDLGKVAAERLLLLEPENSGAYSALANLYSACGKWEEAAKIRKSMKDGR 647 Query: 72 LRKNSGFSW 46 ++K GFSW Sbjct: 648 VKKEQGFSW 656 >ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Glycine max] Length = 748 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/68 (41%), Positives = 47/68 (69%) Frame = -2 Query: 249 LLSACVIHGNVNVGRIAAKELEILKPGNARSYYALASVYKRAGKAEESKRVLDLIWNKEL 70 LLS+C +H N+++G IAA++L L+P N +Y L+++Y G +E R+ +++ +K L Sbjct: 551 LLSSCRVHNNLSLGEIAAEKLFFLEPTNPGNYILLSNIYASKGLWDEENRIREVMKSKGL 610 Query: 69 RKNSGFSW 46 RKN G+SW Sbjct: 611 RKNPGYSW 618 >ref|XP_002878586.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324425|gb|EFH54845.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 786 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/69 (39%), Positives = 49/69 (71%) Frame = -2 Query: 252 TLLSACVIHGNVNVGRIAAKELEILKPGNARSYYALASVYKRAGKAEESKRVLDLIWNKE 73 +LLSAC ++ N+++G++AA+ L +L+P N+ +Y ALA++Y GK EE+ ++ + + Sbjct: 588 SLLSACRVYKNIDLGKVAAERLLLLEPENSGAYSALANLYSACGKWEEAAKIRKSMKDGR 647 Query: 72 LRKNSGFSW 46 ++K GFSW Sbjct: 648 VKKEQGFSW 656