BLASTX nr result
ID: Dioscorea21_contig00040028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00040028 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_01679079.1| conserved hypothetical protein [Vibrio choler... 49 8e-09 ref|ZP_08856823.1| hypothetical protein HMPREF9022_02480, partia... 39 2e-06 ref|ZP_08200493.1| hypothetical protein NBCG_05699 [Nocardioidac... 55 8e-06 >ref|ZP_01679079.1| conserved hypothetical protein [Vibrio cholerae 2740-80] gi|121546188|gb|EAX56522.1| conserved hypothetical protein [Vibrio cholerae 2740-80] Length = 108 Score = 48.5 bits (114), Expect(2) = 8e-09 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +3 Query: 48 VGDHPLRPPKDHRLGEPLPHQLANTT 125 + DHPLRP +D RLGEPLPHQLAN T Sbjct: 1 MADHPLRPARDRRLGEPLPHQLANPT 26 Score = 36.2 bits (82), Expect(2) = 8e-09 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +1 Query: 187 LCGISYRFQ*LSPTTRQVTYALLTR 261 LCGIS+RFQ LSP R ++ ALLTR Sbjct: 45 LCGISHRFQWLSPLYRAISQALLTR 69 >ref|ZP_08856823.1| hypothetical protein HMPREF9022_02480, partial [Erysipelotrichaceae bacterium 2_2_44A] gi|345905407|gb|EGX75147.1| hypothetical protein HMPREF9022_02480 [Erysipelotrichaceae bacterium 2_2_44A] Length = 196 Score = 38.5 bits (88), Expect(2) = 2e-06 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 57 HPLRPPKDHRLGEPLPHQLAN 119 +PLRP HRLG PLPHQLAN Sbjct: 2 YPLRPATHHRLGGPLPHQLAN 22 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = +1 Query: 157 FQVTIMQ*SILCGISYRFQ*LSPTTRQVTYALLTRS 264 F + M+ L G SYRFQ LS T QVTY LLTRS Sbjct: 36 FNILSMRSVYLSGFSYRFQQLSRTHGQVTYVLLTRS 71 >ref|ZP_08200493.1| hypothetical protein NBCG_05699 [Nocardioidaceae bacterium Broad-1] gi|325947935|gb|EGD40054.1| hypothetical protein NBCG_05699 [Nocardioidaceae bacterium Broad-1] Length = 86 Score = 54.7 bits (130), Expect = 8e-06 Identities = 35/73 (47%), Positives = 46/73 (63%) Frame = +1 Query: 46 VWGITLSGPLKIIALVSRYLTN*LIQRRSIW*WCSCTFQVTIMQ*SILCGISYRFQ*LSP 225 +W +TLSG L + ALVS YLTN LI R I TF MQ ++ GI++RF+ LS Sbjct: 1 MWPVTLSGRLPVEALVSHYLTNKLIGREHI--PGRKTFHNHPMQEVVVSGINHRFRWLSQ 58 Query: 226 TTRQVTYALLTRS 264 + Q+T+ LLTRS Sbjct: 59 SLGQITHVLLTRS 71