BLASTX nr result
ID: Dioscorea21_contig00040011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00040011 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633793.1| PREDICTED: leucine-rich repeat receptor prot... 58 7e-07 ref|XP_003528542.1| PREDICTED: serine/threonine-protein kinase B... 58 9e-07 ref|XP_003593778.1| Receptor-like protein kinase [Medicago trunc... 56 3e-06 ref|XP_002444056.1| hypothetical protein SORBIDRAFT_07g006470 [S... 56 3e-06 ref|XP_002458110.1| hypothetical protein SORBIDRAFT_03g027080 [S... 56 3e-06 >ref|XP_003633793.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Length = 1322 Score = 58.2 bits (139), Expect = 7e-07 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 262 HLLSSWTGEDCCTWRGIGCDNKTGHVNMMDLR 357 H LSSW GEDCC WRG+ C+N++GHVN ++LR Sbjct: 60 HRLSSWVGEDCCKWRGVVCNNRSGHVNKLNLR 91 >ref|XP_003528542.1| PREDICTED: serine/threonine-protein kinase BRI1-like 1-like [Glycine max] Length = 913 Score = 57.8 bits (138), Expect = 9e-07 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 262 HLLSSWTGEDCCTWRGIGCDNKTGHVNMMDLR 357 H+LSSW+GEDCC W+GI C+N TG VN +DL+ Sbjct: 24 HILSSWSGEDCCKWKGISCNNLTGRVNRLDLQ 55 >ref|XP_003593778.1| Receptor-like protein kinase [Medicago truncatula] gi|355482826|gb|AES64029.1| Receptor-like protein kinase [Medicago truncatula] Length = 988 Score = 56.2 bits (134), Expect = 3e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +1 Query: 268 LSSWTGEDCCTWRGIGCDNKTGHVNMMDLR 357 LSSW GEDCC W+GI CDN+TGHV +LR Sbjct: 56 LSSWVGEDCCNWKGIECDNQTGHVQKFELR 85 >ref|XP_002444056.1| hypothetical protein SORBIDRAFT_07g006470 [Sorghum bicolor] gi|241940406|gb|EES13551.1| hypothetical protein SORBIDRAFT_07g006470 [Sorghum bicolor] Length = 1010 Score = 55.8 bits (133), Expect = 3e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +1 Query: 262 HLLSSWTGEDCCTWRGIGCDNKTGHVNMMDLR 357 +LL+SW G+DCC WRGI C+NKTGHV + LR Sbjct: 57 NLLASWRGQDCCQWRGIRCNNKTGHVTKLQLR 88 >ref|XP_002458110.1| hypothetical protein SORBIDRAFT_03g027080 [Sorghum bicolor] gi|241930085|gb|EES03230.1| hypothetical protein SORBIDRAFT_03g027080 [Sorghum bicolor] Length = 824 Score = 55.8 bits (133), Expect = 3e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +1 Query: 268 LSSWTGEDCCTWRGIGCDNKTGHVNMMDL 354 LSSW GEDCC W+GIGCDN+T HV +DL Sbjct: 62 LSSWQGEDCCQWKGIGCDNRTSHVVKLDL 90