BLASTX nr result
ID: Dioscorea21_contig00039999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00039999 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002440822.1| hypothetical protein SORBIDRAFT_09g007400 [S... 64 1e-08 ref|XP_002489165.1| hypothetical protein SORBIDRAFT_0015s007030 ... 64 2e-08 ref|XP_003550922.1| PREDICTED: putative ribonuclease H protein A... 60 1e-07 gb|EEC74955.1| hypothetical protein OsI_10942 [Oryza sativa Indi... 60 2e-07 gb|ABA98003.1| retrotransposon protein, putative, unclassified [... 59 3e-07 >ref|XP_002440822.1| hypothetical protein SORBIDRAFT_09g007400 [Sorghum bicolor] gi|241946107|gb|EES19252.1| hypothetical protein SORBIDRAFT_09g007400 [Sorghum bicolor] Length = 835 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/82 (35%), Positives = 48/82 (58%) Frame = -3 Query: 269 SFPFKYLGVLISPKRIAAQSFQCMINKIKSLTSRWTSFNLSPIAKEVLINSTLLSIPIYT 90 +FP KYLGV +SP R+ + +I+K W N+S + LI+S+L + PIY Sbjct: 366 TFPIKYLGVPVSPSRLHVSDWSPLIDKSMKKLDIWKGGNMSIAGRSTLISSSLNNAPIYH 425 Query: 89 LSVYPIHESILSEISKVARKFF 24 +S+Y + +S++ + K+ R FF Sbjct: 426 MSIYLLPKSVIGRLDKIRRNFF 447 >ref|XP_002489165.1| hypothetical protein SORBIDRAFT_0015s007030 [Sorghum bicolor] gi|241947177|gb|EES20322.1| hypothetical protein SORBIDRAFT_0015s007030 [Sorghum bicolor] Length = 933 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/82 (37%), Positives = 50/82 (60%) Frame = -3 Query: 269 SFPFKYLGVLISPKRIAAQSFQCMINKIKSLTSRWTSFNLSPIAKEVLINSTLLSIPIYT 90 SFPFKYLGV +SP RI + + ++ K W +LS ++ LI+STL + P+Y Sbjct: 756 SFPFKYLGVPVSPSRIHVRDWLPIVEKAYRKLDVWKGNSLSIPGRKTLIDSTLSNAPLYQ 815 Query: 89 LSVYPIHESILSEISKVARKFF 24 +S+Y + ++I ++ K+ R FF Sbjct: 816 ISIYLLPKTITYKLDKIRRTFF 837 >ref|XP_003550922.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine max] Length = 549 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/81 (38%), Positives = 48/81 (59%) Frame = -3 Query: 269 SFPFKYLGVLISPKRIAAQSFQCMINKIKSLTSRWTSFNLSPIAKEVLINSTLLSIPIYT 90 SFPF YLG+ I Q ++ +INK + + W +LS + +LINS L SIPIY Sbjct: 152 SFPFTYLGIPIGANPRRCQMWEPLINKCERKLAGWKQRHLSFGGRVILINSVLTSIPIYF 211 Query: 89 LSVYPIHESILSEISKVARKF 27 LS + + ++S+I+++ R F Sbjct: 212 LSFFRVPRQVISKITRLQRNF 232 >gb|EEC74955.1| hypothetical protein OsI_10942 [Oryza sativa Indica Group] Length = 961 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/86 (38%), Positives = 48/86 (55%) Frame = -3 Query: 281 LNQASFPFKYLGVLISPKRIAAQSFQCMINKIKSLTSRWTSFNLSPIAKEVLINSTLLSI 102 + QASF KYLG+ R+ A FQ + + + S W NLS KEVLI S L ++ Sbjct: 481 VQQASFDDKYLGLPTPLGRMKAGRFQALKERFEKRLSEWCEKNLSMGGKEVLIKSVLQAL 540 Query: 101 PIYTLSVYPIHESILSEISKVARKFF 24 P Y +SV+ + S+ E ++ RKF+ Sbjct: 541 PTYVMSVFRLPASLCEEYMQLIRKFW 566 >gb|ABA98003.1| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] Length = 583 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/83 (38%), Positives = 47/83 (56%) Frame = -3 Query: 275 QASFPFKYLGVLISPKRIAAQSFQCMINKIKSLTSRWTSFNLSPIAKEVLINSTLLSIPI 96 +ASFP YLG+ ++P R+ FQ + +KIK S W L + +++NS L +IP Sbjct: 294 RASFPLTYLGLPLTPGRLRKVHFQPLQDKIKGRFSGWKPSLLYMGGRRIMVNSVLSAIPT 353 Query: 95 YTLSVYPIHESILSEISKVARKF 27 YTL+V + L EI K R+F Sbjct: 354 YTLTVLKPPKQSLQEIDKARRRF 376