BLASTX nr result
ID: Dioscorea21_contig00039942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00039942 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26175.3| unnamed protein product [Vitis vinifera] 88 6e-16 ref|XP_002277532.1| PREDICTED: pentatricopeptide repeat-containi... 88 6e-16 ref|XP_003594127.1| Pentatricopeptide repeat-containing protein ... 86 2e-15 ref|XP_003547236.1| PREDICTED: pentatricopeptide repeat-containi... 84 9e-15 ref|XP_002516788.1| pentatricopeptide repeat-containing protein,... 82 3e-14 >emb|CBI26175.3| unnamed protein product [Vitis vinifera] Length = 619 Score = 88.2 bits (217), Expect = 6e-16 Identities = 38/65 (58%), Positives = 49/65 (75%) Frame = -3 Query: 197 VSPNEVMLVNLVSGCGRVTALREGHQLHAVIVKTGLDCHAFLQSTVIHFYMDCQQIELAC 18 V PNEVM+V+L+S CGR A+ EG Q H +IV+TG DC+ F+Q+T+IHFY C +I LA Sbjct: 282 VGPNEVMIVDLISACGRTMAVSEGQQFHGIIVRTGFDCYDFIQATIIHFYAACGEINLAF 341 Query: 17 LQFNL 3 LQF L Sbjct: 342 LQFEL 346 >ref|XP_002277532.1| PREDICTED: pentatricopeptide repeat-containing protein At5g19020, mitochondrial [Vitis vinifera] Length = 694 Score = 88.2 bits (217), Expect = 6e-16 Identities = 38/65 (58%), Positives = 49/65 (75%) Frame = -3 Query: 197 VSPNEVMLVNLVSGCGRVTALREGHQLHAVIVKTGLDCHAFLQSTVIHFYMDCQQIELAC 18 V PNEVM+V+L+S CGR A+ EG Q H +IV+TG DC+ F+Q+T+IHFY C +I LA Sbjct: 312 VGPNEVMIVDLISACGRTMAVSEGQQFHGIIVRTGFDCYDFIQATIIHFYAACGEINLAF 371 Query: 17 LQFNL 3 LQF L Sbjct: 372 LQFEL 376 >ref|XP_003594127.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|124365519|gb|ABN09753.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355483175|gb|AES64378.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 727 Score = 86.3 bits (212), Expect = 2e-15 Identities = 37/63 (58%), Positives = 49/63 (77%) Frame = -3 Query: 191 PNEVMLVNLVSGCGRVTALREGHQLHAVIVKTGLDCHAFLQSTVIHFYMDCQQIELACLQ 12 PNEVM+VNLVS CGR TA+ +G QLH +VK G DC+ F+Q+T+I+FY C ++LACLQ Sbjct: 315 PNEVMIVNLVSACGRGTAIVDGWQLHGTVVKRGFDCYNFIQTTIIYFYAACGMMDLACLQ 374 Query: 11 FNL 3 F + Sbjct: 375 FEV 377 >ref|XP_003547236.1| PREDICTED: pentatricopeptide repeat-containing protein At5g19020, mitochondrial-like [Glycine max] Length = 912 Score = 84.3 bits (207), Expect = 9e-15 Identities = 34/62 (54%), Positives = 49/62 (79%) Frame = -3 Query: 188 NEVMLVNLVSGCGRVTALREGHQLHAVIVKTGLDCHAFLQSTVIHFYMDCQQIELACLQF 9 NE+++VNLVS CGR+ A+ +G QLH ++VK G DC+ F+Q+T+IHFY C ++LACLQF Sbjct: 532 NEILVVNLVSACGRLNAIGDGWQLHGMVVKKGFDCYNFIQTTIIHFYAACGMMDLACLQF 591 Query: 8 NL 3 + Sbjct: 592 EV 593 >ref|XP_002516788.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543876|gb|EEF45402.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 710 Score = 82.4 bits (202), Expect = 3e-14 Identities = 35/63 (55%), Positives = 47/63 (74%) Frame = -3 Query: 191 PNEVMLVNLVSGCGRVTALREGHQLHAVIVKTGLDCHAFLQSTVIHFYMDCQQIELACLQ 12 PN+VM+V+L+SGCGR A+ EG QL + +VK G DC+ F+QST+IH Y C +I ACLQ Sbjct: 328 PNDVMMVDLISGCGRTMAMTEGQQLLSAVVKMGFDCYDFIQSTIIHLYAACGRINEACLQ 387 Query: 11 FNL 3 F + Sbjct: 388 FRI 390