BLASTX nr result
ID: Dioscorea21_contig00039856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00039856 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002436819.1| hypothetical protein SORBIDRAFT_10g009420 [S... 59 4e-07 emb|CAE03671.3| OSJNBa0042N22.14 [Oryza sativa Japonica Group] 57 2e-06 >ref|XP_002436819.1| hypothetical protein SORBIDRAFT_10g009420 [Sorghum bicolor] gi|241915042|gb|EER88186.1| hypothetical protein SORBIDRAFT_10g009420 [Sorghum bicolor] Length = 298 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 1 RVIAHNFLRSSETVSRYFNQVLFAIGELQHEYIRPPS 111 RVIA NF RS ETVSRYFN+VL AIGEL+ +YIRPPS Sbjct: 52 RVIATNFGRSGETVSRYFNKVLHAIGELRDDYIRPPS 88 >emb|CAE03671.3| OSJNBa0042N22.14 [Oryza sativa Japonica Group] Length = 401 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +1 Query: 1 RVIAHNFLRSSETVSRYFNQVLFAIGELQHEYIRPPSAILTP 126 RV+A NF RS ET+SRYFN VL A+GEL+ E IRPPS I TP Sbjct: 61 RVVATNFYRSGETISRYFNLVLHAVGELRKELIRPPS-ITTP 101