BLASTX nr result
ID: Dioscorea21_contig00039789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00039789 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272446.1| PREDICTED: NAC domain-containing protein 8 [... 55 8e-06 >ref|XP_002272446.1| PREDICTED: NAC domain-containing protein 8 [Vitis vinifera] gi|296087593|emb|CBI34849.3| unnamed protein product [Vitis vinifera] Length = 398 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +3 Query: 270 SRTWLVNSRGIARKVKNATIFSDYQIKDFGAEAERECPNC 389 +RTW+V+SRGIARKVKNAT QIKD G A RECPNC Sbjct: 2 ARTWVVDSRGIARKVKNATQSFASQIKDCG--ANRECPNC 39