BLASTX nr result
ID: Dioscorea21_contig00038965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00038965 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003564069.1| PREDICTED: B3 domain-containing protein Os06... 149 2e-34 gb|AFW60989.1| hypothetical protein ZEAMMB73_261802 [Zea mays] 149 2e-34 gb|AFW60986.1| hypothetical protein ZEAMMB73_261802 [Zea mays] 149 2e-34 gb|AFW60985.1| hypothetical protein ZEAMMB73_261802 [Zea mays] 149 2e-34 ref|XP_002445218.1| hypothetical protein SORBIDRAFT_07g006170 [S... 149 2e-34 >ref|XP_003564069.1| PREDICTED: B3 domain-containing protein Os06g0194400-like [Brachypodium distachyon] Length = 226 Score = 149 bits (377), Expect = 2e-34 Identities = 71/106 (66%), Positives = 83/106 (78%) Frame = -1 Query: 323 LGRAYSQRRDLSGRVYASPEARAYAENRADAIQAELDPKFPSFVKPMTQSHVTGGFWLGL 144 L R YS R+DL+ RVYA+ EAR Y +A+ +Q +L +P FVKPMTQSHVTGGFWLGL Sbjct: 89 LSRTYSTRKDLTNRVYATDEARDYTITKAEELQDKLGSDYPIFVKPMTQSHVTGGFWLGL 148 Query: 143 PTHFCRKHLPKRDEHIMLEDESGDTSETLFLARKAGLSAGWRGFSI 6 PT FCRK+LPKRDE I+L DE D SETL+LA K GLSAGWRGF+I Sbjct: 149 PTQFCRKYLPKRDERIILVDEEDDESETLYLALKRGLSAGWRGFAI 194 >gb|AFW60989.1| hypothetical protein ZEAMMB73_261802 [Zea mays] Length = 144 Score = 149 bits (376), Expect = 2e-34 Identities = 70/108 (64%), Positives = 87/108 (80%), Gaps = 1/108 (0%) Frame = -1 Query: 326 RLGRAY-SQRRDLSGRVYASPEARAYAENRADAIQAELDPKFPSFVKPMTQSHVTGGFWL 150 ++ R Y S RRDL+ RVYA+ +AR+YA ++A+ ++ ELD FP F+KPMTQSHVTGGFWL Sbjct: 2 KIRRTYGSVRRDLTNRVYATDDARSYAISKAEDLEQELDSSFPIFIKPMTQSHVTGGFWL 61 Query: 149 GLPTHFCRKHLPKRDEHIMLEDESGDTSETLFLARKAGLSAGWRGFSI 6 GLP HFCRK+LPKRDE I L DE D S+TL+LA K GLSAGWRGF++ Sbjct: 62 GLPIHFCRKYLPKRDEMITLVDEDDDESDTLYLAMKRGLSAGWRGFAV 109 >gb|AFW60986.1| hypothetical protein ZEAMMB73_261802 [Zea mays] Length = 158 Score = 149 bits (376), Expect = 2e-34 Identities = 70/108 (64%), Positives = 87/108 (80%), Gaps = 1/108 (0%) Frame = -1 Query: 326 RLGRAY-SQRRDLSGRVYASPEARAYAENRADAIQAELDPKFPSFVKPMTQSHVTGGFWL 150 ++ R Y S RRDL+ RVYA+ +AR+YA ++A+ ++ ELD FP F+KPMTQSHVTGGFWL Sbjct: 29 KIRRTYGSVRRDLTNRVYATDDARSYAISKAEDLEQELDSSFPIFIKPMTQSHVTGGFWL 88 Query: 149 GLPTHFCRKHLPKRDEHIMLEDESGDTSETLFLARKAGLSAGWRGFSI 6 GLP HFCRK+LPKRDE I L DE D S+TL+LA K GLSAGWRGF++ Sbjct: 89 GLPIHFCRKYLPKRDEMITLVDEDDDESDTLYLAMKRGLSAGWRGFAV 136 >gb|AFW60985.1| hypothetical protein ZEAMMB73_261802 [Zea mays] Length = 232 Score = 149 bits (376), Expect = 2e-34 Identities = 70/108 (64%), Positives = 87/108 (80%), Gaps = 1/108 (0%) Frame = -1 Query: 326 RLGRAY-SQRRDLSGRVYASPEARAYAENRADAIQAELDPKFPSFVKPMTQSHVTGGFWL 150 ++ R Y S RRDL+ RVYA+ +AR+YA ++A+ ++ ELD FP F+KPMTQSHVTGGFWL Sbjct: 90 KIRRTYGSVRRDLTNRVYATDDARSYAISKAEDLEQELDSSFPIFIKPMTQSHVTGGFWL 149 Query: 149 GLPTHFCRKHLPKRDEHIMLEDESGDTSETLFLARKAGLSAGWRGFSI 6 GLP HFCRK+LPKRDE I L DE D S+TL+LA K GLSAGWRGF++ Sbjct: 150 GLPIHFCRKYLPKRDEMITLVDEDDDESDTLYLAMKRGLSAGWRGFAV 197 >ref|XP_002445218.1| hypothetical protein SORBIDRAFT_07g006170 [Sorghum bicolor] gi|241941568|gb|EES14713.1| hypothetical protein SORBIDRAFT_07g006170 [Sorghum bicolor] Length = 230 Score = 149 bits (376), Expect = 2e-34 Identities = 73/118 (61%), Positives = 88/118 (74%) Frame = -1 Query: 359 AVNEDVDKRPRRLGRAYSQRRDLSGRVYASPEARAYAENRADAIQAELDPKFPSFVKPMT 180 A E+V RR+ R Y R+DL+ RVYA+ EAR+Y ++A+ ++ ELD +FP F+KPMT Sbjct: 79 AYREEVPAFARRIRRTYG-RKDLANRVYATDEARSYTISKAEDLEQELDSRFPLFIKPMT 137 Query: 179 QSHVTGGFWLGLPTHFCRKHLPKRDEHIMLEDESGDTSETLFLARKAGLSAGWRGFSI 6 QSHVTGGFWLGLPT FCRKHLPKRDE I L DE S TL+LA K GLS GWRGF+I Sbjct: 138 QSHVTGGFWLGLPTGFCRKHLPKRDETITLVDEDDVESNTLYLAMKKGLSGGWRGFAI 195