BLASTX nr result
ID: Dioscorea21_contig00038951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00038951 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001077907.1| putative protein kinase [Arabidopsis thalian... 61 8e-08 dbj|BAD94080.1| putative protein kinase [Arabidopsis thaliana] g... 61 8e-08 tpg|DAA40790.1| TPA: putative protein kinase superfamily protein... 61 1e-07 ref|XP_003517131.1| PREDICTED: probable serine/threonine-protein... 59 3e-07 ref|NP_001242132.1| uncharacterized protein LOC100784192 [Glycin... 59 3e-07 >ref|NP_001077907.1| putative protein kinase [Arabidopsis thaliana] gi|330251549|gb|AEC06643.1| putative protein kinase [Arabidopsis thaliana] Length = 354 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +2 Query: 2 FSPKGGNGYSEDEDHLALMMELLGKMPKKVRAMHLS 109 F+PK GNGY EDEDHLALMMELLGKMP+KVR ++ Sbjct: 313 FAPKEGNGYGEDEDHLALMMELLGKMPRKVRDQRIT 348 >dbj|BAD94080.1| putative protein kinase [Arabidopsis thaliana] gi|110741340|dbj|BAF02220.1| putative protein kinase [Arabidopsis thaliana] Length = 354 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +2 Query: 2 FSPKGGNGYSEDEDHLALMMELLGKMPKKVRAMHLS 109 F+PK GNGY EDEDHLALMMELLGKMP+KVR ++ Sbjct: 313 FAPKEGNGYGEDEDHLALMMELLGKMPRKVRDQRIT 348 >tpg|DAA40790.1| TPA: putative protein kinase superfamily protein [Zea mays] Length = 734 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 2 FSPKGGNGYSEDEDHLALMMELLGKMPKKVRAM 100 F+PK G+GYSEDEDHLALMMELLGKMPKK+ M Sbjct: 319 FTPKEGHGYSEDEDHLALMMELLGKMPKKIATM 351 >ref|XP_003517131.1| PREDICTED: probable serine/threonine-protein kinase sky1-like [Glycine max] Length = 445 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 2 FSPKGGNGYSEDEDHLALMMELLGKMPKKV 91 F+PKGG G+SEDEDHLALMMELLGKMP+K+ Sbjct: 311 FTPKGGQGFSEDEDHLALMMELLGKMPRKI 340 >ref|NP_001242132.1| uncharacterized protein LOC100784192 [Glycine max] gi|255641978|gb|ACU21256.1| unknown [Glycine max] Length = 446 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 2 FSPKGGNGYSEDEDHLALMMELLGKMPKKV 91 F+PKGG G+SEDEDHLALMMELLGKMP+K+ Sbjct: 312 FTPKGGQGFSEDEDHLALMMELLGKMPRKI 341