BLASTX nr result
ID: Dioscorea21_contig00038839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00038839 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523172.1| pentatricopeptide repeat-containing protein,... 73 2e-11 ref|XP_002299041.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 ref|XP_002266487.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_004154678.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 58 9e-07 ref|XP_004139112.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 >ref|XP_002523172.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537579|gb|EEF39203.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 569 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/71 (50%), Positives = 45/71 (63%) Frame = +1 Query: 1 LQQIHAQTTINGLLLQTGTLIWNSVIRAYGQSPSPIHAILIYNYSIHLGSLLPDNYTYPA 180 L QI QT I L+ T WN +IRAY ++ +PI +IL+ NY I LGS PD YTYP Sbjct: 30 LDQILTQTIITTCLVTHPTSTWNCLIRAYSKTHTPIKSILVSNYFIELGSFYPDRYTYPL 89 Query: 181 LLKACSHLPYS 213 LL ACS L ++ Sbjct: 90 LLNACSRLSFA 100 >ref|XP_002299041.1| predicted protein [Populus trichocarpa] gi|222846299|gb|EEE83846.1| predicted protein [Populus trichocarpa] Length = 601 Score = 69.3 bits (168), Expect = 3e-10 Identities = 38/69 (55%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = +1 Query: 1 LQQIHAQTTINGLLLQTGTLIWNSVIRAYGQSPS-PIHAILIYNYSIHLGSLLPDNYTYP 177 L QI T G T T WN +IRAY +SP+ PI AIL+YN+ I S PDNYTYP Sbjct: 23 LDQILTHTITTGFTYSTPT--WNCLIRAYSRSPTAPIKAILVYNFFIKTCSTRPDNYTYP 80 Query: 178 ALLKACSHL 204 LLKACS L Sbjct: 81 CLLKACSRL 89 >ref|XP_002266487.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 553 Score = 66.6 bits (161), Expect = 2e-09 Identities = 37/76 (48%), Positives = 48/76 (63%) Frame = +1 Query: 7 QIHAQTTINGLLLQTGTLIWNSVIRAYGQSPSPIHAILIYNYSIHLGSLLPDNYTYPALL 186 Q+ QT + T T WN +IRA+ +SP+PI AILIYN+ I + PD YTYPA+L Sbjct: 24 QVLTQTITTAFIHATPT--WNCLIRAFSRSPTPITAILIYNHFIKGRFVFPDKYTYPAML 81 Query: 187 KACSHLPYSLPKAREV 234 KAC + SL K +EV Sbjct: 82 KACWRMG-SLSKGKEV 96 >ref|XP_004154678.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Cucumis sativus] Length = 681 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = +1 Query: 64 WNSVIRAYGQSPSPIHAILIYNYSIHLGSLLPDNYTYPALLKACS 198 WN IR Y +S +PI+A+L+Y + GS +PDNYTYP L K C+ Sbjct: 122 WNMAIRGYVESENPINAVLLYRNMLRKGSAIPDNYTYPLLFKVCA 166 >ref|XP_004139112.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Cucumis sativus] Length = 681 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = +1 Query: 64 WNSVIRAYGQSPSPIHAILIYNYSIHLGSLLPDNYTYPALLKACS 198 WN IR Y +S +PI+A+L+Y + GS +PDNYTYP L K C+ Sbjct: 122 WNMAIRGYVESENPINAVLLYRNMLRKGSAIPDNYTYPLLFKVCA 166