BLASTX nr result
ID: Dioscorea21_contig00038688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00038688 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002461471.1| hypothetical protein SORBIDRAFT_02g003170 [S... 68 7e-10 gb|AFK09767.1| drought and salt tolerance protein [Triticum aest... 66 3e-09 ref|XP_003559356.1| PREDICTED: uncharacterized protein LOC100827... 66 3e-09 dbj|BAJ96359.1| predicted protein [Hordeum vulgare subsp. vulgare] 66 3e-09 ref|XP_002443573.1| hypothetical protein SORBIDRAFT_08g021800 [S... 66 3e-09 >ref|XP_002461471.1| hypothetical protein SORBIDRAFT_02g003170 [Sorghum bicolor] gi|241924848|gb|EER97992.1| hypothetical protein SORBIDRAFT_02g003170 [Sorghum bicolor] Length = 212 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 105 EQSMRIFPCLFCDKKFLKSQALGGHQNAHKKERS 4 +Q R+FPCLFCDKKFLKSQALGGHQNAHKKER+ Sbjct: 47 KQEARLFPCLFCDKKFLKSQALGGHQNAHKKERA 80 >gb|AFK09767.1| drought and salt tolerance protein [Triticum aestivum] Length = 294 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 102 QSMRIFPCLFCDKKFLKSQALGGHQNAHKKERS 4 + +R+FPCLFC+KKFLKSQALGGHQNAHKKERS Sbjct: 48 KDVRLFPCLFCNKKFLKSQALGGHQNAHKKERS 80 >ref|XP_003559356.1| PREDICTED: uncharacterized protein LOC100827210 [Brachypodium distachyon] Length = 289 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 102 QSMRIFPCLFCDKKFLKSQALGGHQNAHKKERS 4 + +R+FPCLFC+KKFLKSQALGGHQNAHKKERS Sbjct: 46 KDVRLFPCLFCNKKFLKSQALGGHQNAHKKERS 78 >dbj|BAJ96359.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 289 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 102 QSMRIFPCLFCDKKFLKSQALGGHQNAHKKERS 4 + +R+FPCLFC+KKFLKSQALGGHQNAHKKERS Sbjct: 47 KDVRLFPCLFCNKKFLKSQALGGHQNAHKKERS 79 >ref|XP_002443573.1| hypothetical protein SORBIDRAFT_08g021800 [Sorghum bicolor] gi|241944266|gb|EES17411.1| hypothetical protein SORBIDRAFT_08g021800 [Sorghum bicolor] Length = 202 Score = 66.2 bits (160), Expect = 3e-09 Identities = 35/70 (50%), Positives = 41/70 (58%), Gaps = 4/70 (5%) Frame = -3 Query: 201 PPPTSSSQLHXXXXXXXXXXXXXXXXXPNAVVEQS----MRIFPCLFCDKKFLKSQALGG 34 PPP+SSS H ++ +R+FPCLFC+KKFLKSQALGG Sbjct: 32 PPPSSSSHDHATTAAAASSSSDGAAGGGGGGGSRASGGGVRLFPCLFCNKKFLKSQALGG 91 Query: 33 HQNAHKKERS 4 HQNAHKKERS Sbjct: 92 HQNAHKKERS 101