BLASTX nr result
ID: Dioscorea21_contig00038678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00038678 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003611118.1| PIF-like transposase [Medicago truncatula] g... 55 8e-06 >ref|XP_003611118.1| PIF-like transposase [Medicago truncatula] gi|355512453|gb|AES94076.1| PIF-like transposase [Medicago truncatula] Length = 284 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = +2 Query: 257 TQISRELRLQGDKARDELMSHLLSSDLCHNMIRMSPRAFLG*CETLGRDGGLRPT 421 T +SR R G + R+E+M L +S+ N+IRM P+ FL C+ L R+GGLRPT Sbjct: 132 TWMSRSSRKDGQRVREEVMYRLKNSETSRNIIRMGPQTFLKLCDMLEREGGLRPT 186