BLASTX nr result
ID: Dioscorea21_contig00038381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00038381 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002463918.1| hypothetical protein SORBIDRAFT_01g008890 [S... 57 2e-06 >ref|XP_002463918.1| hypothetical protein SORBIDRAFT_01g008890 [Sorghum bicolor] gi|241917772|gb|EER90916.1| hypothetical protein SORBIDRAFT_01g008890 [Sorghum bicolor] Length = 565 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = -3 Query: 159 GMDQNLYQAVTQGNVQRLKSLTDKEPKLLLSRTPHENTALHIAAKLGHKEVA 4 GMD LY+A TQG V+ L+ L K+ K+L S+TP +NTALH+AA GH + A Sbjct: 8 GMDPALYKAATQGCVRSLRKLVVKDVKILNSKTPQDNTALHLAALHGHPKFA 59