BLASTX nr result
ID: Dioscorea21_contig00038277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00038277 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21766.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002266198.1| PREDICTED: mitotic spindle assembly checkpoi... 57 2e-06 >emb|CBI21766.3| unnamed protein product [Vitis vinifera] Length = 183 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKNTIPQEETSRILVEFLEVAVTSIVFLKGVYP 3 R+N PQ ET+RILVEFLEVA+TSIVFLKG+YP Sbjct: 4 RENQSPQNETARILVEFLEVAITSIVFLKGIYP 36 >ref|XP_002266198.1| PREDICTED: mitotic spindle assembly checkpoint protein MAD2B [Vitis vinifera] Length = 204 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 101 RKNTIPQEETSRILVEFLEVAVTSIVFLKGVYP 3 R+N PQ ET+RILVEFLEVA+TSIVFLKG+YP Sbjct: 4 RENQSPQNETARILVEFLEVAITSIVFLKGIYP 36