BLASTX nr result
ID: Dioscorea21_contig00038098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00038098 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_194887.1| putative xyloglucan glycosyltransferase 5 [Arab... 79 3e-13 ref|XP_002515366.1| transferase, transferring glycosyl groups, p... 77 1e-12 gb|AFZ78581.1| cellulose synthase-like protein [Populus tomentosa] 77 1e-12 ref|XP_002867293.1| hypothetical protein ARALYDRAFT_491580 [Arab... 77 1e-12 ref|XP_002308730.1| predicted protein [Populus trichocarpa] gi|2... 75 4e-12 >ref|NP_194887.1| putative xyloglucan glycosyltransferase 5 [Arabidopsis thaliana] gi|75201904|sp|Q9SB75.1|CSLC5_ARATH RecName: Full=Probable xyloglucan glycosyltransferase 5; AltName: Full=Cellulose synthase-like protein C5; Short=AtCslC5 gi|3281868|emb|CAA19764.1| putative protein [Arabidopsis thaliana] gi|7270062|emb|CAB79877.1| putative protein [Arabidopsis thaliana] gi|28058784|gb|AAO29953.1| putative protein [Arabidopsis thaliana] gi|30725520|gb|AAP37782.1| At4g31590 [Arabidopsis thaliana] gi|332660533|gb|AEE85933.1| putative xyloglucan glycosyltransferase 5 [Arabidopsis thaliana] Length = 692 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = +1 Query: 136 MAPRLDFSEWWAKEERKGTPLVVTMENPNYSLLEIQCPDSEEFHNVGKAKGKN 294 MAPRLDFS+WWAK+ RKGTP+VV MENPNYS++EI PDS F V K++GKN Sbjct: 1 MAPRLDFSDWWAKDTRKGTPVVVKMENPNYSVVEIDGPDS-AFRPVEKSRGKN 52 >ref|XP_002515366.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223545310|gb|EEF46815.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 693 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/53 (66%), Positives = 44/53 (83%) Frame = +1 Query: 136 MAPRLDFSEWWAKEERKGTPLVVTMENPNYSLLEIQCPDSEEFHNVGKAKGKN 294 MAPRLDFS+WWAK+ +KGTP+VV MENPNYS++EI PD+ F V K++GKN Sbjct: 1 MAPRLDFSDWWAKDSKKGTPVVVKMENPNYSVVEINGPDA-AFQPVEKSRGKN 52 >gb|AFZ78581.1| cellulose synthase-like protein [Populus tomentosa] Length = 693 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/53 (66%), Positives = 43/53 (81%) Frame = +1 Query: 136 MAPRLDFSEWWAKEERKGTPLVVTMENPNYSLLEIQCPDSEEFHNVGKAKGKN 294 MAPRLDFS+WW K+ +KGTP+VV MENPNYS++EI PDS F V K++GKN Sbjct: 1 MAPRLDFSDWWGKDRKKGTPVVVKMENPNYSVVEINGPDS-AFRPVEKSRGKN 52 >ref|XP_002867293.1| hypothetical protein ARALYDRAFT_491580 [Arabidopsis lyrata subsp. lyrata] gi|297313129|gb|EFH43552.1| hypothetical protein ARALYDRAFT_491580 [Arabidopsis lyrata subsp. lyrata] Length = 692 Score = 77.0 bits (188), Expect = 1e-12 Identities = 36/53 (67%), Positives = 43/53 (81%) Frame = +1 Query: 136 MAPRLDFSEWWAKEERKGTPLVVTMENPNYSLLEIQCPDSEEFHNVGKAKGKN 294 MAP LDFS+WWAK+ RKGTP+VV MENPNYS++EI PDS F V K++GKN Sbjct: 1 MAPSLDFSDWWAKDTRKGTPVVVKMENPNYSVVEIDGPDS-AFRPVEKSRGKN 52 >ref|XP_002308730.1| predicted protein [Populus trichocarpa] gi|222854706|gb|EEE92253.1| predicted protein [Populus trichocarpa] Length = 693 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/53 (64%), Positives = 43/53 (81%) Frame = +1 Query: 136 MAPRLDFSEWWAKEERKGTPLVVTMENPNYSLLEIQCPDSEEFHNVGKAKGKN 294 MAPRLDFS+WW K+ ++GTP+VV MENPNYS++EI PDS F V K++GKN Sbjct: 1 MAPRLDFSDWWGKDSKEGTPVVVKMENPNYSVVEINGPDS-AFRPVEKSRGKN 52