BLASTX nr result
ID: Dioscorea21_contig00038038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00038038 (619 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003559785.1| PREDICTED: probable galacturonosyltransferas... 63 5e-08 dbj|BAJ88752.1| predicted protein [Hordeum vulgare subsp. vulgare] 61 2e-07 tpg|DAA45181.1| TPA: hypothetical protein ZEAMMB73_911889 [Zea m... 60 4e-07 tpg|DAA45180.1| TPA: hypothetical protein ZEAMMB73_911889 [Zea m... 60 4e-07 gb|AFW88474.1| transferase [Zea mays] 60 4e-07 >ref|XP_003559785.1| PREDICTED: probable galacturonosyltransferase 7-like [Brachypodium distachyon] Length = 620 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/33 (78%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +3 Query: 3 MKPWLELGIPSYKKFWRKYLTKE-QFMDECNVS 98 MKPWLELGIP Y+K+WR+YLT+E QFMDECNV+ Sbjct: 587 MKPWLELGIPDYRKYWRRYLTREDQFMDECNVN 619 >dbj|BAJ88752.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 154 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/33 (75%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +3 Query: 3 MKPWLELGIPSYKKFWRKYLTKE-QFMDECNVS 98 MKPWLELGIP YKK+WR++LT+E +FMDECNV+ Sbjct: 121 MKPWLELGIPDYKKYWRRFLTREDRFMDECNVN 153 >tpg|DAA45181.1| TPA: hypothetical protein ZEAMMB73_911889 [Zea mays] Length = 613 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/33 (72%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +3 Query: 3 MKPWLELGIPSYKKFWRKYLTK-EQFMDECNVS 98 MKPWLELGIP Y+K+W+++LT+ E+FMDECNVS Sbjct: 580 MKPWLELGIPDYRKYWKRFLTRDERFMDECNVS 612 >tpg|DAA45180.1| TPA: hypothetical protein ZEAMMB73_911889 [Zea mays] Length = 629 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/33 (72%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +3 Query: 3 MKPWLELGIPSYKKFWRKYLTK-EQFMDECNVS 98 MKPWLELGIP Y+K+W+++LT+ E+FMDECNVS Sbjct: 596 MKPWLELGIPDYRKYWKRFLTRDERFMDECNVS 628 >gb|AFW88474.1| transferase [Zea mays] Length = 629 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/33 (72%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +3 Query: 3 MKPWLELGIPSYKKFWRKYLTK-EQFMDECNVS 98 MKPWLELGIP Y+K+W+++LT+ E+FMDECNVS Sbjct: 596 MKPWLELGIPDYRKYWKRFLTRDERFMDECNVS 628