BLASTX nr result
ID: Dioscorea21_contig00037936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00037936 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633097.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 >ref|XP_003633097.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Vitis vinifera] Length = 1005 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/79 (40%), Positives = 46/79 (58%), Gaps = 11/79 (13%) Frame = -1 Query: 228 INHPNSVDYTPRNRQPAA-----------FDSGGILRSYSIMLQCCTSKRSVLEGKSVHA 82 ++ PN + TP N+ P FDS G LR YS ML+ C SK + EGK++H Sbjct: 93 LSSPNRPNSTPGNKIPETVEKKRIWRGLDFDSKGRLRQYSGMLRTCASKGDLNEGKAIHG 152 Query: 81 RLLRSNVEPDVHLWDCLVN 25 ++++S + PD HLW+ LVN Sbjct: 153 QVIKSGINPDSHLWNSLVN 171