BLASTX nr result
ID: Dioscorea21_contig00037663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00037663 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283473.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 80 1e-13 ref|XP_002330523.1| predicted protein [Populus trichocarpa] gi|2... 78 7e-13 ref|XP_004135678.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 76 2e-12 ref|XP_002514201.1| Glucan endo-1,3-beta-glucosidase precursor, ... 75 6e-12 ref|XP_003530515.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 74 9e-12 >ref|XP_002283473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Vitis vinifera] gi|297738738|emb|CBI27983.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 294 CRGSTIGVCYGRNADDLPTPDKVAQLVQLHNIKYVRIY 407 CRGSTIGVCYGRNADDLPTPDKVAQLVQLH IKY+RIY Sbjct: 21 CRGSTIGVCYGRNADDLPTPDKVAQLVQLHKIKYLRIY 58 >ref|XP_002330523.1| predicted protein [Populus trichocarpa] gi|222872457|gb|EEF09588.1| predicted protein [Populus trichocarpa] Length = 455 Score = 78.2 bits (191), Expect = 7e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 294 CRGSTIGVCYGRNADDLPTPDKVAQLVQLHNIKYVRIY 407 CRGSTIGVCYGRNADDLPTPDKVAQLVQ H IKY+RIY Sbjct: 22 CRGSTIGVCYGRNADDLPTPDKVAQLVQQHKIKYLRIY 59 >ref|XP_004135678.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis sativus] gi|449489811|ref|XP_004158423.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis sativus] Length = 501 Score = 76.3 bits (186), Expect = 2e-12 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +3 Query: 294 CRGSTIGVCYGRNADDLPTPDKVAQLVQLHNIKYVRIY 407 C+GS +GVCYGRNADDLPTP+KVAQLV+LHNIKY+RIY Sbjct: 24 CQGSNVGVCYGRNADDLPTPNKVAQLVKLHNIKYIRIY 61 >ref|XP_002514201.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] gi|223546657|gb|EEF48155.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] Length = 511 Score = 75.1 bits (183), Expect = 6e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 294 CRGSTIGVCYGRNADDLPTPDKVAQLVQLHNIKYVRIY 407 CRGSTIGVCYGRNADDLPTPDKVAQLVQ IKY+RIY Sbjct: 21 CRGSTIGVCYGRNADDLPTPDKVAQLVQQQKIKYLRIY 58 >ref|XP_003530515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Glycine max] Length = 483 Score = 74.3 bits (181), Expect = 9e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +3 Query: 294 CRGSTIGVCYGRNADDLPTPDKVAQLVQLHNIKYVRIY 407 C GS +GVCYGR+ADDLPTPDKVAQLVQLH IKYVRIY Sbjct: 21 CSGSFVGVCYGRSADDLPTPDKVAQLVQLHKIKYVRIY 58