BLASTX nr result
ID: Dioscorea21_contig00037432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00037432 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW81867.1| hypothetical protein ZEAMMB73_495459 [Zea mays] 112 3e-23 ref|XP_002441139.1| hypothetical protein SORBIDRAFT_09g021140 [S... 112 3e-23 gb|EEE63798.1| hypothetical protein OsJ_18622 [Oryza sativa Japo... 109 2e-22 gb|EEC79266.1| hypothetical protein OsI_20049 [Oryza sativa Indi... 109 2e-22 gb|ACC64532.1| beta-galactosidase 6 inactive isoform [Oryza sati... 109 2e-22 >gb|AFW81867.1| hypothetical protein ZEAMMB73_495459 [Zea mays] Length = 759 Score = 112 bits (280), Expect = 3e-23 Identities = 49/63 (77%), Positives = 56/63 (88%) Frame = -1 Query: 189 NFEGRYDLVRFTKGVRKHGLYVSLRIGPFIESEWKFGGFRFWLHDIPSIVFRSDNEPFQF 10 NFEGRYDLVRF K ++ GLYVSLRIGPFIESEWK+GGF FWLHD+P+I FRSDNEPF+ Sbjct: 81 NFEGRYDLVRFIKEIQAQGLYVSLRIGPFIESEWKYGGFPFWLHDVPNITFRSDNEPFKQ 140 Query: 9 YMQ 1 +MQ Sbjct: 141 HMQ 143 >ref|XP_002441139.1| hypothetical protein SORBIDRAFT_09g021140 [Sorghum bicolor] gi|241946424|gb|EES19569.1| hypothetical protein SORBIDRAFT_09g021140 [Sorghum bicolor] Length = 784 Score = 112 bits (280), Expect = 3e-23 Identities = 49/63 (77%), Positives = 56/63 (88%) Frame = -1 Query: 189 NFEGRYDLVRFTKGVRKHGLYVSLRIGPFIESEWKFGGFRFWLHDIPSIVFRSDNEPFQF 10 NFEGRYDLVRF K ++ GLYVSLRIGPFIESEWK+GGF FWLHD+P+I FRSDNEPF+ Sbjct: 105 NFEGRYDLVRFIKEIQAQGLYVSLRIGPFIESEWKYGGFPFWLHDVPNITFRSDNEPFKQ 164 Query: 9 YMQ 1 +MQ Sbjct: 165 HMQ 167 >gb|EEE63798.1| hypothetical protein OsJ_18622 [Oryza sativa Japonica Group] Length = 765 Score = 109 bits (273), Expect = 2e-22 Identities = 46/63 (73%), Positives = 56/63 (88%) Frame = -1 Query: 189 NFEGRYDLVRFTKGVRKHGLYVSLRIGPFIESEWKFGGFRFWLHDIPSIVFRSDNEPFQF 10 NFEGRYDLV+F + ++ GLYVSLRIGPF+E+EWK+GGF FWLHD+PSI FRSDNEPF+ Sbjct: 92 NFEGRYDLVKFIREIQAQGLYVSLRIGPFVEAEWKYGGFPFWLHDVPSITFRSDNEPFKQ 151 Query: 9 YMQ 1 +MQ Sbjct: 152 HMQ 154 >gb|EEC79266.1| hypothetical protein OsI_20049 [Oryza sativa Indica Group] Length = 761 Score = 109 bits (273), Expect = 2e-22 Identities = 46/63 (73%), Positives = 56/63 (88%) Frame = -1 Query: 189 NFEGRYDLVRFTKGVRKHGLYVSLRIGPFIESEWKFGGFRFWLHDIPSIVFRSDNEPFQF 10 NFEGRYDLV+F + ++ GLYVSLRIGPF+E+EWK+GGF FWLHD+PSI FRSDNEPF+ Sbjct: 88 NFEGRYDLVKFIREIQAQGLYVSLRIGPFVEAEWKYGGFPFWLHDVPSITFRSDNEPFKQ 147 Query: 9 YMQ 1 +MQ Sbjct: 148 HMQ 150 >gb|ACC64532.1| beta-galactosidase 6 inactive isoform [Oryza sativa Indica Group] Length = 244 Score = 109 bits (273), Expect = 2e-22 Identities = 46/63 (73%), Positives = 56/63 (88%) Frame = -1 Query: 189 NFEGRYDLVRFTKGVRKHGLYVSLRIGPFIESEWKFGGFRFWLHDIPSIVFRSDNEPFQF 10 NFEGRYDLV+F + ++ GLYVSLRIGPF+E+EWK+GGF FWLHD+PSI FRSDNEPF+ Sbjct: 92 NFEGRYDLVKFIREIQAQGLYVSLRIGPFVEAEWKYGGFPFWLHDVPSITFRSDNEPFKQ 151 Query: 9 YMQ 1 +MQ Sbjct: 152 HMQ 154