BLASTX nr result
ID: Dioscorea21_contig00037252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00037252 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626724.1| hypothetical protein MTR_8g006370 [Medicago ... 65 7e-09 gb|AAM14832.1| unknown protein [Arabidopsis thaliana] 64 1e-08 ref|XP_002274075.2| PREDICTED: uncharacterized protein LOC100263... 64 2e-08 emb|CBI16628.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|NP_850428.1| alpha/beta-hydrolase domain-containing protein ... 63 2e-08 >ref|XP_003626724.1| hypothetical protein MTR_8g006370 [Medicago truncatula] gi|355520746|gb|AET01200.1| hypothetical protein MTR_8g006370 [Medicago truncatula] Length = 521 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = +1 Query: 31 SIIGGFRERAVKVVKGSKDDIGWLQRAHGMPPVQDGTDRFDNLLSNIK 174 SI +RA + V+GS DDIGWLQ A GMPPV+DGT+RF +L NIK Sbjct: 169 SIFRSLIDRARRTVRGSADDIGWLQHAQGMPPVEDGTERFQEILDNIK 216 >gb|AAM14832.1| unknown protein [Arabidopsis thaliana] Length = 461 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = +1 Query: 31 SIIGGFRERAVKVVKGSKDDIGWLQRAHGMPPVQDGTDRFDNLLSNIKSSEP 186 S+ G ERA + V+GS DDIGWLQRA MPPV+DGTDRF+ +L +I + P Sbjct: 132 SMFQGLIERARRTVRGSADDIGWLQRAPEMPPVEDGTDRFNKILEDIGNHGP 183 >ref|XP_002274075.2| PREDICTED: uncharacterized protein LOC100263281 [Vitis vinifera] Length = 505 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = +1 Query: 31 SIIGGFRERAVKVVKGSKDDIGWLQRAHGMPPVQDGTDRFDNLLSNIK 174 SI G +RA + V+GS DDIGW+QRA GMPPV+DGTDRF ++ I+ Sbjct: 151 SIFQGLIDRARRTVRGSADDIGWIQRAPGMPPVEDGTDRFMEIIDEIR 198 >emb|CBI16628.3| unnamed protein product [Vitis vinifera] Length = 552 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = +1 Query: 31 SIIGGFRERAVKVVKGSKDDIGWLQRAHGMPPVQDGTDRFDNLLSNIK 174 SI G +RA + V+GS DDIGW+QRA GMPPV+DGTDRF ++ I+ Sbjct: 198 SIFQGLIDRARRTVRGSADDIGWIQRAPGMPPVEDGTDRFMEIIDEIR 245 >ref|NP_850428.1| alpha/beta-hydrolase domain-containing protein [Arabidopsis thaliana] gi|25054931|gb|AAN71942.1| unknown protein [Arabidopsis thaliana] gi|330255396|gb|AEC10490.1| alpha/beta-hydrolase domain-containing protein [Arabidopsis thaliana] Length = 503 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +1 Query: 31 SIIGGFRERAVKVVKGSKDDIGWLQRAHGMPPVQDGTDRFDNLLSNI 171 S+ G ERA + V+GS DDIGWLQRA MPPV+DGTDRF+ +L +I Sbjct: 154 SMFQGLIERARRTVRGSADDIGWLQRAPEMPPVEDGTDRFNKILEDI 200