BLASTX nr result
ID: Dioscorea21_contig00037183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00037183 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003576515.1| PREDICTED: fidgetin-like protein 1-like [Bra... 58 7e-07 >ref|XP_003576515.1| PREDICTED: fidgetin-like protein 1-like [Brachypodium distachyon] Length = 687 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/74 (37%), Positives = 42/74 (56%), Gaps = 4/74 (5%) Frame = +2 Query: 47 DVEKEHACCHNLLKANSE----PVVLQIDAKDKPHGMAQKTKRRHTEFTSPICESTRSPT 214 D+ K+ A N ++ N P+ L ++ +K G Q KR+HT F SPICE SP+ Sbjct: 210 DISKDFAGVENEIRTNQNDNRHPIYLGVEEDEKHCGQFQSAKRKHTGFRSPICEHANSPS 269 Query: 215 NNEEYNADTSVNGF 256 +N+E +A S +GF Sbjct: 270 SNDEADAPASASGF 283