BLASTX nr result
ID: Dioscorea21_contig00037155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00037155 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACG28136.1| hypothetical protein [Zea mays] gi|195617542|gb|A... 67 1e-09 ref|XP_003537349.1| PREDICTED: uncharacterized protein LOC100818... 65 8e-09 ref|XP_003575424.1| PREDICTED: uncharacterized protein LOC100821... 64 2e-08 ref|XP_003611791.1| hypothetical protein MTR_5g017880 [Medicago ... 62 5e-08 dbj|BAK06529.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 7e-07 >gb|ACG28136.1| hypothetical protein [Zea mays] gi|195617542|gb|ACG30601.1| hypothetical protein [Zea mays] Length = 42 Score = 67.4 bits (163), Expect = 1e-09 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +3 Query: 27 MEAPSSQAMSISEDTQDKVVDECCSCCYDCLESFFYYLCC 146 ME PS+QAMS ++D QDK VDECCSCCYDC S +LCC Sbjct: 1 MEPPSAQAMSATDDFQDKAVDECCSCCYDCCSSILDFLCC 40 >ref|XP_003537349.1| PREDICTED: uncharacterized protein LOC100818910 [Glycine max] Length = 50 Score = 64.7 bits (156), Expect = 8e-09 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 7/49 (14%) Frame = +3 Query: 27 MEAPSSQAMSIS-------EDTQDKVVDECCSCCYDCLESFFYYLCCDF 152 ME P SQ++ IS +DTQDKV++ECCSCCYDC + F +LCC+F Sbjct: 1 MEPPPSQSIEISGHGYQAGDDTQDKVINECCSCCYDCTQGLFDFLCCNF 49 >ref|XP_003575424.1| PREDICTED: uncharacterized protein LOC100821837 [Brachypodium distachyon] Length = 41 Score = 63.5 bits (153), Expect = 2e-08 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +3 Query: 27 MEAPSSQAMSISEDTQDKVVDECCSCCYDCLESFFYYLCC 146 M+ P +Q MS +ED QDK VDECCSCCYDC S +LCC Sbjct: 1 MDPPPAQTMSATEDLQDKSVDECCSCCYDCCSSILDFLCC 40 >ref|XP_003611791.1| hypothetical protein MTR_5g017880 [Medicago truncatula] gi|355513126|gb|AES94749.1| hypothetical protein MTR_5g017880 [Medicago truncatula] Length = 79 Score = 62.0 bits (149), Expect = 5e-08 Identities = 23/46 (50%), Positives = 34/46 (73%), Gaps = 4/46 (8%) Frame = +3 Query: 27 MEAPSSQAMSIS----EDTQDKVVDECCSCCYDCLESFFYYLCCDF 152 M+ P +Q++ IS +D QDK++++CCSCCYDC + FF +LCC F Sbjct: 1 MDPPQTQSIDISNPAGDDLQDKIINDCCSCCYDCTQGFFDFLCCSF 46 >dbj|BAK06529.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 41 Score = 58.2 bits (139), Expect = 7e-07 Identities = 22/40 (55%), Positives = 28/40 (70%) Frame = +3 Query: 27 MEAPSSQAMSISEDTQDKVVDECCSCCYDCLESFFYYLCC 146 ME P +Q+MS ++D DK +D CCSCCYDC S +LCC Sbjct: 1 MEPPPAQSMSATDDLHDKSLDGCCSCCYDCCSSILDFLCC 40