BLASTX nr result
ID: Dioscorea21_contig00036126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00036126 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAO23078.1| polyprotein [Glycine max] 60 2e-07 emb|CAN66607.1| hypothetical protein VITISV_017554 [Vitis vinifera] 55 4e-06 emb|CAN76793.1| hypothetical protein VITISV_026680 [Vitis vinifera] 55 8e-06 >gb|AAO23078.1| polyprotein [Glycine max] Length = 1552 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = -2 Query: 232 QRRNPPFYTRSVKLDFPRFEGEDVLNWIYKAEQFFRYYQIPLAE 101 +++ F RSVKLDFPRF+G++V++WI+KAEQFF YY P A+ Sbjct: 87 EQQRSSFQVRSVKLDFPRFDGKNVMDWIFKAEQFFDYYATPDAD 130 >emb|CAN66607.1| hypothetical protein VITISV_017554 [Vitis vinifera] Length = 2822 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/46 (52%), Positives = 31/46 (67%) Frame = -2 Query: 226 RNPPFYTRSVKLDFPRFEGEDVLNWIYKAEQFFRYYQIPLAEIPHH 89 RN TR+V+LDFP+F GED W+Y+A+QFF Y+Q PHH Sbjct: 45 RNGGIQTRAVRLDFPKFNGEDPSGWVYRADQFFNYHQTN----PHH 86 >emb|CAN76793.1| hypothetical protein VITISV_026680 [Vitis vinifera] Length = 1469 Score = 54.7 bits (130), Expect = 8e-06 Identities = 35/104 (33%), Positives = 54/104 (51%), Gaps = 8/104 (7%) Frame = -2 Query: 376 EQREERMNLMEQTLHTMSKCLETLQIAKSVPPMEGSSPVRIELMEEVDQRR--NPPF--- 212 EQ ++ N ++Q + ++ LE +A +V + E +R+ NP F Sbjct: 24 EQYQQNHNSLQQVVEGLAHQLEV--VASNVQTLVQMKTKHNSGDSEGSKRQMTNPLFEDN 81 Query: 211 ---YTRSVKLDFPRFEGEDVLNWIYKAEQFFRYYQIPLAEIPHH 89 TR+V+LDFP+F GED W+Y+A+QFF Y+Q PHH Sbjct: 82 GGIQTRAVRLDFPKFNGEDPNGWVYRADQFFNYHQTN----PHH 121