BLASTX nr result
ID: Dioscorea21_contig00035940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00035940 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002453948.1| hypothetical protein SORBIDRAFT_04g022050 [S... 55 8e-06 >ref|XP_002453948.1| hypothetical protein SORBIDRAFT_04g022050 [Sorghum bicolor] gi|241933779|gb|EES06924.1| hypothetical protein SORBIDRAFT_04g022050 [Sorghum bicolor] Length = 1052 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +2 Query: 2 VSVIRIGLLCSKESPLERMPMRDVSKEMHAIRDA 103 +SVIRIG+ CSK+ P ERMP+RD + EMHAIRDA Sbjct: 998 ISVIRIGISCSKQQPRERMPIRDAATEMHAIRDA 1031