BLASTX nr result
ID: Dioscorea21_contig00035736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00035736 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519191.1| pentatricopeptide repeat-containing protein,... 118 4e-25 ref|XP_002885175.1| pentatricopeptide repeat-containing protein ... 101 6e-20 ref|NP_188314.1| pentatricopeptide repeat-containing protein [Ar... 101 7e-20 ref|XP_004162218.1| PREDICTED: putative pentatricopeptide repeat... 100 9e-20 ref|XP_004134500.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 100 9e-20 >ref|XP_002519191.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541506|gb|EEF43055.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 719 Score = 118 bits (296), Expect = 4e-25 Identities = 65/116 (56%), Positives = 80/116 (68%) Frame = +1 Query: 58 KFPKYIDPDRLCVILSQKDWFLMLNTEFKSIAAHLGPQSVVSVLQKLENPLFSLKFYIWA 237 K+ K ID ILS+ DWFL+LN EFK+ L SV SVLQ ENPL+ LKFYIW Sbjct: 77 KYSKPIDHHYFSRILSRHDWFLLLNHEFKAKRITLNSHSVASVLQNQENPLYPLKFYIWV 136 Query: 238 SNLDDKFAKDRFVRKVLVELLWRKGPVVLSVELVNEIRSSSCGIITEDLLCILMCS 405 SN+D FAKD+ V+ VL L+RKGPVVLSVEL+ +I++S I E+LLCIL+ S Sbjct: 137 SNMDPLFAKDQSVKGVLANCLYRKGPVVLSVELLKDIKASGYR-INEELLCILIGS 191 >ref|XP_002885175.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297331015|gb|EFH61434.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 653 Score = 101 bits (252), Expect = 6e-20 Identities = 50/103 (48%), Positives = 74/103 (71%) Frame = +1 Query: 97 ILSQKDWFLMLNTEFKSIAAHLGPQSVVSVLQKLENPLFSLKFYIWASNLDDKFAKDRFV 276 ++ +KDWFL+LN EF + L + V+SVLQ +NPL SL+FY+W SN D +AKD+ + Sbjct: 47 VIERKDWFLILNQEFTTHRIGLNIRFVISVLQNQDNPLHSLRFYLWVSNTDPVYAKDQSL 106 Query: 277 RKVLVELLWRKGPVVLSVELVNEIRSSSCGIITEDLLCILMCS 405 + VL L+RKGP++LS+EL+ EIR S IT++L+C+L+ S Sbjct: 107 KSVLGNALFRKGPLLLSMELLKEIRESGYR-ITDELMCVLIGS 148 >ref|NP_188314.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75274022|sp|Q9LSQ2.1|PP239_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial; AltName: Full=Protein PENTATRICOPEPTIDE REPEAT 40; Flags: Precursor gi|7670019|dbj|BAA94973.1| salt-inducible protein-like [Arabidopsis thaliana] gi|332642359|gb|AEE75880.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 659 Score = 101 bits (251), Expect = 7e-20 Identities = 49/103 (47%), Positives = 74/103 (71%) Frame = +1 Query: 97 ILSQKDWFLMLNTEFKSIAAHLGPQSVVSVLQKLENPLFSLKFYIWASNLDDKFAKDRFV 276 ++ +KDWFL+LN EF + L + V+SVLQ +NPL SL+FY+W SN D +AKD+ + Sbjct: 53 VIERKDWFLILNQEFTTHRIGLNTRFVISVLQNQDNPLHSLRFYLWVSNFDPVYAKDQSL 112 Query: 277 RKVLVELLWRKGPVVLSVELVNEIRSSSCGIITEDLLCILMCS 405 + VL L+RKGP++LS+EL+ EIR S I+++L+C+L+ S Sbjct: 113 KSVLGNALFRKGPLLLSMELLKEIRDSGYR-ISDELMCVLIGS 154 >ref|XP_004162218.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like [Cucumis sativus] Length = 697 Score = 100 bits (250), Expect = 9e-20 Identities = 56/116 (48%), Positives = 76/116 (65%), Gaps = 3/116 (2%) Frame = +1 Query: 67 KYIDPDRLCVILSQKDWFLMLNTEFKSIAAHLGPQSVVSVLQKLENPLFSLKFYIWASNL 246 K ID + IL KDWFL+LN EFK+ L PQ VVS+LQ +NPL +++FYIW SN+ Sbjct: 89 KPIDRSYISKILLSKDWFLLLNHEFKAKRVVLSPQFVVSILQNQDNPLSAIRFYIWVSNV 148 Query: 247 DDKFAKDRFVRKVLVELLWRKG---PVVLSVELVNEIRSSSCGIITEDLLCILMCS 405 D K + ++ VLV L R+G PV+LSV+L+ +I+ S +TE+LLCIL S Sbjct: 149 DPLLVKKQLIQGVLVRNLHREGPDRPVLLSVDLLQQIKESGLK-VTEELLCILFGS 203 >ref|XP_004134500.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like [Cucumis sativus] Length = 688 Score = 100 bits (250), Expect = 9e-20 Identities = 56/116 (48%), Positives = 76/116 (65%), Gaps = 3/116 (2%) Frame = +1 Query: 67 KYIDPDRLCVILSQKDWFLMLNTEFKSIAAHLGPQSVVSVLQKLENPLFSLKFYIWASNL 246 K ID + IL KDWFL+LN EFK+ L PQ VVS+LQ +NPL +++FYIW SN+ Sbjct: 89 KPIDRSYISKILLSKDWFLLLNHEFKAKRVVLSPQFVVSILQNQDNPLSAIRFYIWVSNV 148 Query: 247 DDKFAKDRFVRKVLVELLWRKG---PVVLSVELVNEIRSSSCGIITEDLLCILMCS 405 D K + ++ VLV L R+G PV+LSV+L+ +I+ S +TE+LLCIL S Sbjct: 149 DPLLVKKQLIQGVLVRNLHREGPDRPVLLSVDLLQQIKESGLK-VTEELLCILFGS 203