BLASTX nr result
ID: Dioscorea21_contig00034847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00034847 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301558.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 ref|XP_002270749.1| PREDICTED: tankyrase-2-like [Vitis vinifera] 59 4e-07 emb|CAN75193.1| hypothetical protein VITISV_016148 [Vitis vinifera] 59 4e-07 ref|XP_002520713.1| ankyrin repeat-containing protein, putative ... 59 5e-07 >ref|XP_002301558.1| predicted protein [Populus trichocarpa] gi|222843284|gb|EEE80831.1| predicted protein [Populus trichocarpa] Length = 478 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +2 Query: 74 MDRLVSVDLKELEIEYRPSRRCRSSTFIITNLMHTMSVAIHLTTTPPS 217 MDRLV D+KE+EI Y+ S+ C S+TF +TNLMHTMSVAI L+TT PS Sbjct: 1 MDRLVKADVKEVEIAYKGSQNC-STTFRLTNLMHTMSVAISLSTTNPS 47 >ref|XP_002270749.1| PREDICTED: tankyrase-2-like [Vitis vinifera] Length = 472 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = +2 Query: 74 MDRLVSVDLKELEIEYRPSRRCRSSTFIITNLMHTMSVAIHLTTTPPS 217 MDRLV D+KE+EI ++ ++C ++TF +TNLMHTMSVA+ LTTT PS Sbjct: 1 MDRLVKPDVKEVEIIFKRGQKC-NTTFRLTNLMHTMSVAVSLTTTNPS 47 >emb|CAN75193.1| hypothetical protein VITISV_016148 [Vitis vinifera] Length = 472 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = +2 Query: 74 MDRLVSVDLKELEIEYRPSRRCRSSTFIITNLMHTMSVAIHLTTTPPS 217 MDRLV D+KE+EI ++ ++C ++TF +TNLMHTMSVA+ LTTT PS Sbjct: 1 MDRLVKPDVKEVEIIFKRGQKC-NTTFRLTNLMHTMSVAVSLTTTNPS 47 >ref|XP_002520713.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223540098|gb|EEF41675.1| ankyrin repeat-containing protein, putative [Ricinus communis] Length = 484 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/48 (56%), Positives = 38/48 (79%) Frame = +2 Query: 74 MDRLVSVDLKELEIEYRPSRRCRSSTFIITNLMHTMSVAIHLTTTPPS 217 MDRLV D+KE+EI ++ ++C ++TF ++NLMHTMSVA+ L TT PS Sbjct: 1 MDRLVKADVKEIEISFKKGQKC-TATFRLSNLMHTMSVAVSLATTSPS 47