BLASTX nr result
ID: Dioscorea21_contig00034764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00034764 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516276.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 >ref|XP_002516276.1| conserved hypothetical protein [Ricinus communis] gi|223544762|gb|EEF46278.1| conserved hypothetical protein [Ricinus communis] Length = 238 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/85 (40%), Positives = 54/85 (63%) Frame = +2 Query: 17 VRQAISRFHDGKSKSFTYLAGAASRASLSQGNTKHENPCTFKHKNILGFTDLLDELSNRN 196 +++ IS+F++GKSKSFT LA A+S +S+ K ENP T K KN+L +L D+ ++ Sbjct: 94 IKRGISKFYNGKSKSFTSLADASSASSIKDF-VKPENPYTRKRKNLLARKNLWDDKNHNR 152 Query: 197 LLQNMGRGTPKKPNNSSHSIPSVNN 271 L ++ G PK+P S+ S + +N Sbjct: 153 LPRDNGSCIPKRPATSNRSAVARDN 177