BLASTX nr result
ID: Dioscorea21_contig00034640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00034640 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526713.1| conserved hypothetical protein [Ricinus comm... 106 2e-21 emb|CAN78493.1| hypothetical protein VITISV_037041 [Vitis vinifera] 106 2e-21 gb|ABD63142.1| Retrotransposon gag protein [Asparagus officinalis] 98 6e-19 ref|XP_003631512.1| PREDICTED: uncharacterized protein LOC100852... 96 2e-18 ref|XP_003631302.1| PREDICTED: uncharacterized protein LOC100854... 96 2e-18 >ref|XP_002526713.1| conserved hypothetical protein [Ricinus communis] gi|223533946|gb|EEF35670.1| conserved hypothetical protein [Ricinus communis] Length = 496 Score = 106 bits (264), Expect = 2e-21 Identities = 51/81 (62%), Positives = 66/81 (81%) Frame = +1 Query: 7 MPSKKKDPGSFIIPCNIGNLGEEMALADSGASINVMPYTFFRKLGLGEPRPTKMTLQLAD 186 +P K++D SF IPC IG+L ALAD GASIN+MP + F KLGL EP+PT+M++QLAD Sbjct: 261 LPLKRRDLESFTIPCMIGDLSISGALADLGASINLMPTSLFAKLGLHEPKPTRMSVQLAD 320 Query: 187 RSVRRPRGIVEDVLVKVDKYI 249 R+V+ PRGI+EDVL+KVDK+I Sbjct: 321 RTVKIPRGIIEDVLIKVDKFI 341 >emb|CAN78493.1| hypothetical protein VITISV_037041 [Vitis vinifera] Length = 1048 Score = 106 bits (264), Expect = 2e-21 Identities = 49/83 (59%), Positives = 63/83 (75%) Frame = +1 Query: 1 QNMPSKKKDPGSFIIPCNIGNLGEEMALADSGASINVMPYTFFRKLGLGEPRPTKMTLQL 180 + +P K KDPGSF IPC IG+ + L D G S+N+MP + FRKLGLGE + T + LQL Sbjct: 342 RELPPKLKDPGSFTIPCTIGDFDFDKVLCDLGESVNLMPLSIFRKLGLGEVKLTTVCLQL 401 Query: 181 ADRSVRRPRGIVEDVLVKVDKYI 249 ADRS++ PRGI+EDVLVKVDK++ Sbjct: 402 ADRSIKHPRGIIEDVLVKVDKFL 424 >gb|ABD63142.1| Retrotransposon gag protein [Asparagus officinalis] Length = 1788 Score = 98.2 bits (243), Expect = 6e-19 Identities = 47/81 (58%), Positives = 63/81 (77%) Frame = +1 Query: 7 MPSKKKDPGSFIIPCNIGNLGEEMALADSGASINVMPYTFFRKLGLGEPRPTKMTLQLAD 186 MP K KDPG IPC IGN + AL D GAS+N++PY+ +++LG+GE +PT+ TLQLAD Sbjct: 535 MPLKYKDPGCPTIPCVIGNTHIDKALLDLGASVNLLPYSVYQQLGVGELKPTRCTLQLAD 594 Query: 187 RSVRRPRGIVEDVLVKVDKYI 249 RSV+ P+G VEDVL+KV ++I Sbjct: 595 RSVKIPKGEVEDVLIKVGEFI 615 >ref|XP_003631512.1| PREDICTED: uncharacterized protein LOC100852941 [Vitis vinifera] Length = 1380 Score = 96.3 bits (238), Expect = 2e-18 Identities = 46/79 (58%), Positives = 60/79 (75%) Frame = +1 Query: 10 PSKKKDPGSFIIPCNIGNLGEEMALADSGASINVMPYTFFRKLGLGEPRPTKMTLQLADR 189 P K KDPG I NIG E AL D GAS+N++PY+ +++LGLGE +PT +TL LADR Sbjct: 324 PIKYKDPGCPTISVNIGGTQVEKALLDLGASVNLLPYSVYKELGLGELKPTSITLSLADR 383 Query: 190 SVRRPRGIVEDVLVKVDKY 246 SV+ PRG++EDVLV+VDK+ Sbjct: 384 SVKIPRGVIEDVLVQVDKF 402 >ref|XP_003631302.1| PREDICTED: uncharacterized protein LOC100854568 [Vitis vinifera] Length = 921 Score = 96.3 bits (238), Expect = 2e-18 Identities = 46/79 (58%), Positives = 60/79 (75%) Frame = +1 Query: 10 PSKKKDPGSFIIPCNIGNLGEEMALADSGASINVMPYTFFRKLGLGEPRPTKMTLQLADR 189 P K KDPG I NIG E AL D GAS+N++PY+ +++LGLGE +PT +TL LADR Sbjct: 212 PIKYKDPGCPTISVNIGGTQVEKALLDLGASVNLLPYSVYKELGLGELKPTSITLSLADR 271 Query: 190 SVRRPRGIVEDVLVKVDKY 246 SV+ PRG++EDVLV+VDK+ Sbjct: 272 SVKIPRGVIEDVLVQVDKF 290