BLASTX nr result
ID: Dioscorea21_contig00034449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00034449 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526567.1| oligopeptide transporter, putative [Ricinus ... 124 1e-26 ref|XP_002301861.1| predicted protein [Populus trichocarpa] gi|2... 122 2e-26 ref|XP_002526568.1| oligopeptide transporter, putative [Ricinus ... 122 3e-26 ref|XP_003535206.1| PREDICTED: peptide transporter PTR3-A-like [... 122 4e-26 ref|XP_003519709.1| PREDICTED: peptide transporter PTR3-A-like [... 122 4e-26 >ref|XP_002526567.1| oligopeptide transporter, putative [Ricinus communis] gi|223534128|gb|EEF35845.1| oligopeptide transporter, putative [Ricinus communis] Length = 598 Score = 124 bits (310), Expect = 1e-26 Identities = 54/71 (76%), Positives = 66/71 (92%) Frame = -2 Query: 215 FNWWMFSIFFGTLFANSFLVYIQDHVGFSVGYALPTFGLMFSVLVFLIGTPYYRHKLPSG 36 FNWWMFSIFFGTLF+++FL+YIQD+VG+S+GY LPT GL S++VFLIGTP+YRHKLP+G Sbjct: 201 FNWWMFSIFFGTLFSSTFLIYIQDNVGWSLGYGLPTAGLAVSIIVFLIGTPFYRHKLPAG 260 Query: 35 SPFTKIAAVLV 3 +PFTKIA VLV Sbjct: 261 TPFTKIAQVLV 271 >ref|XP_002301861.1| predicted protein [Populus trichocarpa] gi|222843587|gb|EEE81134.1| predicted protein [Populus trichocarpa] Length = 604 Score = 122 bits (307), Expect = 2e-26 Identities = 53/71 (74%), Positives = 66/71 (92%) Frame = -2 Query: 215 FNWWMFSIFFGTLFANSFLVYIQDHVGFSVGYALPTFGLMFSVLVFLIGTPYYRHKLPSG 36 FNWWMFSIFFGTLF+N+FLVYIQD+VG+++GYALPT GL S++VFL+GTP+YRHKLP+ Sbjct: 199 FNWWMFSIFFGTLFSNTFLVYIQDNVGWTLGYALPTLGLAVSIIVFLVGTPFYRHKLPAE 258 Query: 35 SPFTKIAAVLV 3 SPFT++A VLV Sbjct: 259 SPFTRMAQVLV 269 >ref|XP_002526568.1| oligopeptide transporter, putative [Ricinus communis] gi|223534129|gb|EEF35846.1| oligopeptide transporter, putative [Ricinus communis] Length = 597 Score = 122 bits (306), Expect = 3e-26 Identities = 54/71 (76%), Positives = 65/71 (91%) Frame = -2 Query: 215 FNWWMFSIFFGTLFANSFLVYIQDHVGFSVGYALPTFGLMFSVLVFLIGTPYYRHKLPSG 36 FNWWMFSIFFGTLF+N+FLVYIQD+VG+++GYALPT GL S+ VFL+GT +YRHKLP+G Sbjct: 198 FNWWMFSIFFGTLFSNTFLVYIQDNVGWTLGYALPTVGLAVSIAVFLVGTQFYRHKLPAG 257 Query: 35 SPFTKIAAVLV 3 SPFT+IA VLV Sbjct: 258 SPFTRIAQVLV 268 >ref|XP_003535206.1| PREDICTED: peptide transporter PTR3-A-like [Glycine max] Length = 590 Score = 122 bits (305), Expect = 4e-26 Identities = 53/71 (74%), Positives = 64/71 (90%) Frame = -2 Query: 215 FNWWMFSIFFGTLFANSFLVYIQDHVGFSVGYALPTFGLMFSVLVFLIGTPYYRHKLPSG 36 FNWWMFSIF GTLFANS LVYIQD+VG+++GYALPT GL S+++FL GTP+YRHKLP+G Sbjct: 190 FNWWMFSIFIGTLFANSVLVYIQDNVGWTLGYALPTLGLAISIIIFLAGTPFYRHKLPTG 249 Query: 35 SPFTKIAAVLV 3 SPFTK+A V+V Sbjct: 250 SPFTKMAKVIV 260 >ref|XP_003519709.1| PREDICTED: peptide transporter PTR3-A-like [Glycine max] Length = 635 Score = 122 bits (305), Expect = 4e-26 Identities = 53/71 (74%), Positives = 64/71 (90%) Frame = -2 Query: 215 FNWWMFSIFFGTLFANSFLVYIQDHVGFSVGYALPTFGLMFSVLVFLIGTPYYRHKLPSG 36 FNWWMFSIF GTLFANS LVYIQD+VG+++GYALPT GL S+++FL GTP+YRHKLP+G Sbjct: 190 FNWWMFSIFIGTLFANSVLVYIQDNVGWTLGYALPTLGLAISIIIFLAGTPFYRHKLPTG 249 Query: 35 SPFTKIAAVLV 3 SPFTK+A V+V Sbjct: 250 SPFTKMAKVIV 260