BLASTX nr result
ID: Dioscorea21_contig00034305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00034305 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632946.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 emb|CBI23204.3| unnamed protein product [Vitis vinifera] 66 3e-09 ref|XP_002874797.1| pentatricopeptide repeat-containing protein ... 64 2e-08 ref|XP_003547263.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 ref|NP_192346.1| pentatricopeptide repeat-containing protein [Ar... 62 5e-08 >ref|XP_003632946.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04370-like [Vitis vinifera] Length = 732 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/64 (43%), Positives = 43/64 (67%) Frame = +1 Query: 118 LSYASTFLRSIPPCPQSFPTLIKACANLGLLSASVLLHQHAVVHGYASDAYIDSSLVHMY 297 L+Y+S PP +FP+L+KAC +L L S + HQ +V GY+SD+YI +SL++ Y Sbjct: 34 LTYSSMLSTDTPPDAHTFPSLVKACTSLDLFSHGLSFHQRVIVDGYSSDSYIATSLINFY 93 Query: 298 AKYG 309 +K+G Sbjct: 94 SKFG 97 >emb|CBI23204.3| unnamed protein product [Vitis vinifera] Length = 907 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/64 (43%), Positives = 43/64 (67%) Frame = +1 Query: 118 LSYASTFLRSIPPCPQSFPTLIKACANLGLLSASVLLHQHAVVHGYASDAYIDSSLVHMY 297 L+Y+S PP +FP+L+KAC +L L S + HQ +V GY+SD+YI +SL++ Y Sbjct: 34 LTYSSMLSTDTPPDAHTFPSLVKACTSLDLFSHGLSFHQRVIVDGYSSDSYIATSLINFY 93 Query: 298 AKYG 309 +K+G Sbjct: 94 SKFG 97 >ref|XP_002874797.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297320634|gb|EFH51056.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 748 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/63 (44%), Positives = 46/63 (73%) Frame = +1 Query: 121 SYASTFLRSIPPCPQSFPTLIKACANLGLLSASVLLHQHAVVHGYASDAYIDSSLVHMYA 300 +++S + P +FP+L+KAC +L LLS + +HQ +V+G++SD+YI SSLV++YA Sbjct: 33 TFSSMLANKLLPDTFTFPSLLKACTSLQLLSFGLSIHQKVLVNGFSSDSYISSSLVNLYA 92 Query: 301 KYG 309 K+G Sbjct: 93 KFG 95 >ref|XP_003547263.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04370-like [Glycine max] Length = 764 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/63 (46%), Positives = 42/63 (66%) Frame = +1 Query: 121 SYASTFLRSIPPCPQSFPTLIKACANLGLLSASVLLHQHAVVHGYASDAYIDSSLVHMYA 300 +YAS +P +FP+L+KAC++L L S + LHQ +V G + DAYI SSL++ YA Sbjct: 56 TYASMLKTHVPSDAYTFPSLLKACSSLNLFSLGLSLHQRILVSGLSLDAYIASSLINFYA 115 Query: 301 KYG 309 K+G Sbjct: 116 KFG 118 >ref|NP_192346.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75214457|sp|Q9XE98.1|PP303_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g04370 gi|4982476|gb|AAD36944.1|AF069441_4 hypothetical protein [Arabidopsis thaliana] gi|7267194|emb|CAB77905.1| hypothetical protein [Arabidopsis thaliana] gi|332656985|gb|AEE82385.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 729 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/63 (44%), Positives = 45/63 (71%) Frame = +1 Query: 121 SYASTFLRSIPPCPQSFPTLIKACANLGLLSASVLLHQHAVVHGYASDAYIDSSLVHMYA 300 +++S + P +FP+L+KACA+L LS + +HQ +V+G++SD YI SSLV++YA Sbjct: 33 TFSSMLANKLLPDTFTFPSLLKACASLQRLSFGLSIHQQVLVNGFSSDFYISSSLVNLYA 92 Query: 301 KYG 309 K+G Sbjct: 93 KFG 95