BLASTX nr result
ID: Dioscorea21_contig00034282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00034282 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002438450.1| hypothetical protein SORBIDRAFT_10g019990 [S... 56 3e-06 >ref|XP_002438450.1| hypothetical protein SORBIDRAFT_10g019990 [Sorghum bicolor] gi|241916673|gb|EER89817.1| hypothetical protein SORBIDRAFT_10g019990 [Sorghum bicolor] Length = 298 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/62 (50%), Positives = 35/62 (56%) Frame = +2 Query: 5 WPKSDQPPMIPPEPANKNRGRKPLLRRREVDEEPTGFTKGKVCRKGINIHCSICGKTGHN 184 WP SD P + P K GR + RRRE EEP G K+ R GI + CS CGKTGHN Sbjct: 94 WPISDMPRPLAPAYV-KMPGRPKIQRRREQGEEPKGT---KLSRVGIKMRCSCCGKTGHN 149 Query: 185 KR 190 R Sbjct: 150 SR 151